KEGG   Sinorhizobium meliloti 2011: SM2011_a0400Help
Entry
SM2011_a0400      CDS       T02497                                 

Definition
(GenBank) Dehydrogenase,Zn-dependent
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SM2011_a0400
Enzymes [BR:smel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SM2011_a0400
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SM2011_a0400
    1.1.1.-  
     SM2011_a0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AGG69903
Position
pSymA:216460..217473
Genome map
AA seq 337 aa AA seqDB search
MKAVRLYDIRDLRVEEVAELAAPPPGFVNLEVRAAGICGSDLHNYRTGQWISRRPSTAGH
EFCGRVTAIGEGVSHLVRGDVVSADSRMWCGTCPACASGRSNVCETLGFLGEVCDGGFAE
AVQLPSRLVFRHDPKLSPHVAAMAEPLAVALHAVRRLAVPDGAPVLVMGCGTIGGLSALL
LSRLHQGPLLLTDLNADKAALVAEVTGGVVVALDGAAIEEALPGTRLRHALDATGSIQAI
ARALDILSGGGALALVGIGHGKLDLDPNILVEREISLVGCHAFAGELPEAIELLADLAPA
LQRFIEVLPTLDDVPEAYERLLRGESNALKTIIEVAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgcggctctacgacatcagggacttgcgcgtggaggaggtggccgaattg
gccgcgccgccgccgggtttcgtcaaccttgaagtgagggccgccggcatctgcggttct
gaccttcacaactaccgtaccggccaatggatctcgcgacggccctcgacggcaggccat
gaattctgcggtcgcgtgactgcaatcggagagggcgtcagccacctcgtgcggggagac
gtcgtctctgcggattcacggatgtggtgtggcacctgcccggcctgcgcgagcggccgc
agcaatgtctgcgagactttgggcttcttgggcgaggtctgcgacggcggctttgccgag
gcggtgcaactgccgtcgcgactggtcttccgccacgatcccaagctttccccgcatgtg
gccgccatggccgaaccgctggctgtggcgttgcacgccgtgcgtcggctcgccgtgcct
gacggcgcaccggttctcgtcatgggctgcggcacgatcggcgggttaagcgcccttctg
ctctcccggttacatcagggtccgttgctgctgaccgatttgaacgccgacaaggccgcc
cttgtcgccgaggtgaccggcggtgtggtggttgcactcgacggggcggcgatcgaggaa
gcgttgcccggcacaagactgcgccatgcgctggatgcgaccggcagtatccaggcgatc
gcgagggcgctcgacattctgtctggcggcggagcgctggcgctcgtcggcatcggacac
ggtaagctcgatctggacccgaacattctggtcgagcgggagatttcgctcgtcggctgc
catgcgtttgcgggcgagttgcccgaggccatcgaattgctcgccgatctggcgccggcg
ctgcaacgtttcattgaggtgctgccgacgctcgacgatgtgccggaagcttatgaaagg
ctgctgcgaggcgagagcaatgcgctcaagacgatcatcgaggtggcgggctga

DBGET integrated database retrieval system