KEGG   Sinorhizobium meliloti 2011: SM2011_b20132
Entry
SM2011_b20132     CDS       T02497                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00230  Purine metabolism
smel01100  Metabolic pathways
smel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SM2011_b20132
Enzymes [BR:smel01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SM2011_b20132
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGG71130
Position
pSymB:143977..146295
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHEDVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
DVDRGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDIAPSGHPI
VGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKAEPENLAIRDGFVVVTNGSNRSIRLSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLQVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgacagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgctcatgcg
cgcatcaggagcatcgacacgagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgaggacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcc
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggcgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcaccatcgaagccgcatcggtgcccggcgctccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
gacgtcgataggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcggc
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtccggtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggccgc
tgcatctataccaattcgccgattgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgacctcatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgagggcgacatcgcaccctccgggcacccgatc
gtcggacacggcctgggggattgcatccgccgcgtcatggaggagacgaactggcacgaa
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacgctgatcaccggcaccgccggcctcggcaccggcgcgcat
acggcgctttcgcagatcgtcgccgaggaactcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaaggccgagcccgagaatctcgcgattcgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccggctttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactggtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtcgccgttctc
caggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacag
atcgagggcggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgacggacgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcgccggatcccggaggtccctac
ggtgccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atctacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system