KEGG   Sinorhizobium meliloti 2011: SM2011_b20170Help
Entry
SM2011_b20170     CDS       T02497                                 

Definition
(GenBank) putative S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00010  Glycolysis / Gluconeogenesis
smel00071  Fatty acid degradation
smel00350  Tyrosine metabolism
smel00625  Chloroalkane and chloroalkene degradation
smel00626  Naphthalene degradation
smel00680  Methane metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01120  Microbial metabolism in diverse environments
smel01130  Biosynthesis of antibiotics
smel01200  Carbon metabolism
smel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SM2011_b20170
  09102 Energy metabolism
   00680 Methane metabolism
    SM2011_b20170
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SM2011_b20170
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SM2011_b20170
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SM2011_b20170
   00626 Naphthalene degradation
    SM2011_b20170
Enzymes [BR:smel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SM2011_b20170
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SM2011_b20170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AGG71169
Position
pSymB:188406..189533
Genome map
AA seq 375 aa AA seqDB search
MRTRAALAVQAGKPLVVTEVELEGPRAGEVLVEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRSCPSCLSRKTNLCTAIRATQGQGLMPD
GSSRFSINGDKIHHYMGCSTFSNFTVLPEIALAKVNPDAPFDKICYIGCGVTTGIGAVIN
TAKVEIGATAIVFGLGGIGLNVIQGLRLAGADMIIGVDLNNDKKPWGEKFGMTHFVNPKE
VGDDIVPYLVNLTKRGADQIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQ
EISTRPFQLVTGRTWMGTAFGGARGRTDVPKIVDWYMEGKIEIDPMITHTMPLEDINKGF
ELMHSGESIRSVVLY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactcgcgctgctctggccgttcaggccggaaaaccccttgtcgtgaccgaagta
gagctcgaaggcccgcgggccggcgaggtgctggtcgaggtgaaggcgaccggcatctgc
cataccgacgatttcacgctgtcgggcgccgatccggaggggctgttcccggcgatcctc
ggtcatgagggcgccggcatcgtcgtcgatgtcggccccggcgtcacctcggtgaagaag
ggcgaccacgtcatcccgctctatacgccggaatgccgctcctgcccctcctgcctcagc
cgcaagaccaatctgtgcaccgccatccgcgccacccaggggcaagggctgatgccggac
ggcagctcgcggttctcgatcaacggcgacaagatccaccattatatgggctgctcgacc
ttctcgaacttcaccgtgctgccggagatcgcgctcgccaaggtcaatccggacgccccc
ttcgacaagatctgctatatcggctgcggcgtcaccaccggcatcggcgcggtgatcaac
accgccaaggtcgagatcggcgccaccgccatcgtcttcggcctcggcggcatcgggctc
aacgtcatccaggggcttcgccttgccggcgccgacatgatcatcggcgtcgacctcaac
aacgacaagaagccctggggcgaaaagttcggcatgacccacttcgtcaatccgaaggag
gtcggcgacgacatcgtcccctatctcgtcaacctgacgaagcgcggtgccgaccagatc
ggcggcgccgactacaccttcgactgcaccggcaacaccaaggtcatgcgccaggcgctc
gaagcctcgcatcgcggctggggcaagtcggtgatcatcggcgtcgccggcgccggccag
gagatttcgaccaggccgttccagctcgtcaccggccgcacctggatgggcaccgcgttt
ggcggcgcgcgcggccgcaccgacgtgccgaagatcgtcgactggtacatggagggcaag
atcgagatcgatccgatgatcacccacaccatgccgctcgaggacatcaacaagggtttc
gagctcatgcattccggcgagagcattcgaagcgtggtcctctattga

DBGET integrated database retrieval system