KEGG   Sinorhizobium meliloti 2011: SM2011_b20490Help
Entry
SM2011_b20490     CDS       T02497                                 

Gene name
fucA2
Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00051  Fructose and mannose metabolism
smel01100  Metabolic pathways
smel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SM2011_b20490 (fucA2)
Enzymes [BR:smel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SM2011_b20490 (fucA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGG71472
Position
pSymB:506813..507511
Genome map
AA seq 232 aa AA seqDB search
MAETETDKLALRREMVDICRRMNLSGINQGTAGNLSVRTDDGFLITPSSMPYDTMQPDDL
VEMGFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHKTIPSFHYMTG
IAGGTTIRCAEYATFGTQALSDNALLALKDRLACLLGQHGQISLGKTLEQALWLAIEVET
LSRIYVQALTLGEPPILPDDEMERVIAQMRRMSYGQAPDPEGVNDVARPRVS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctgagactgagacggacaagctggcactccggcgggaaatggtggacatctgccgg
cggatgaatttgagcggcatcaaccagggcacggccggcaatctttccgtccgcaccgat
gacggcttcctcatcacgccgtcctccatgccctatgacacgatgcagccggacgacctg
gtggaaatgggcttcgatggcacctatgtgggccatcgaccctcatcggagtggcgcttc
catcgcgacattctgcgcgcgcgcacggatatcgacgtggtcctgcattgccactcgatc
tacgcgacgacacttgcctgccatcacaagaccattccgagctttcactacatgacgggg
attgccggcggcacgacgatccgctgcgccgaatatgcgaccttcggcacgcaggccctg
tcggacaacgcgctcctcgcgcttaaagaccgccttgcatgcctgctcgggcagcacggc
cagatatcgctcggcaaaacgctggaacaggcattgtggcttgcgatcgaggtagagacg
ctgtcgcggatctatgtccaggccctgacgctcggcgagccgcccatactgccggacgac
gaaatggagcgggtgatcgcccagatgcggcgcatgagctacggccaggcgccggacccg
gagggagtgaacgacgtggcgcgcccgcgcgtgtcgtga

DBGET integrated database retrieval system