KEGG   Sinorhizobium meliloti 2011: SM2011_b21648Help
Entry
SM2011_b21648     CDS       T02497                                 

Gene name
melA
Definition
(GenBank) Alpha-galactosidase,melibiase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00052  Galactose metabolism
smel00561  Glycerolipid metabolism
smel00600  Sphingolipid metabolism
smel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smel00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SM2011_b21648 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SM2011_b21648 (melA)
   00600 Sphingolipid metabolism
    SM2011_b21648 (melA)
Enzymes [BR:smel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SM2011_b21648 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AGG72577
Position
pSymB:complement(1678741..1680213)
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSIGFTKKLFTDILSVPELRDVEFALTDLSEHNLAMIKSILDRIVEANE
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLETIRRSNEHASRILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAKWLPQYAHAIDAAKERLARATVATREWKGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccatcatcggcgccggcagcatcggcttcaccaagaagctc
ttcaccgacattctttccgtgccggagctccgggacgtcgagttcgcgttgacggatctg
agcgagcacaacctcgccatgatcaagtctatcctcgaccggatcgtcgaggcgaacgaa
ctgcccacgcgggtgacggcgacgaccgaccgccgcaaggcgctggaaggtgcgcgctac
atcatcagctgcgtgcgcgtcggcggcctcgaggcctatgccgacgatattcgcattcca
ttgaagtacggcgtcgaccaatgcgtcggcgacacgatctgcgccggcggcatcctctac
ggccagcgcaacattccggtgatcctggatttctgcaaggacatccgcgaggtggcggag
cccggcgccaagttcctcaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccacggcgtccagcacggggccgagcag
atcgccgagattctcggcgccagggacggggagctcgactacatctgctccggcatcaac
caccagacatggttcgtcgatgtccgtctcaacggccgcaaggtcggcaaggacgaactc
gtcgccgccttcgaggcacatcccgtcttttccaagcaggagaagctccggatcgacgta
ttgaagcgcttcggcgtctattcgaccgaaagcaacggacatctgtccgaatacctgccc
tggtaccgcaagcgtccggacgagatctccagatggatcgacatgtcggactggatccac
ggggagaccggcgggtatctccgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaggcgggccggccgctggaaacgatcaggcgctcgaacgaa
catgcgagccgcatcctcgaagcgctcgagacgggtcgggtctatcgcggccacttcaac
gtcaagaacaacggcgtgatcaccaacctgccggcagatgcgatcatcgaatcccccggc
ttcgtcgatcggttcggcatcaacatggtggcaggcatcacgttgccggaggcctgtgcg
gccacctgcatctcgtcggtcaacgtccaacgcatgtccgttcatgcggcgatcaccggc
gacatcgatctcctgaagctcgccgtgctgcacgacccgctggtcggcgccatctgcacg
ccggaggaagtctggcagatggtcgacgaaatggtggtcgcgcaggccaaatggctgccg
caatatgcccatgcaatcgacgcggccaaggaaaggctcgcccgcgccacggtcgccacc
cgggagtggaagggcgccgcgcgtcgcgaggtgcgctcgatcgaggagatccgcgcggag
aaggaagcggcgaagctgcgcgctgcggggtag

DBGET integrated database retrieval system