KEGG   Sinorhizobium meliloti 2011: SM2011_c00262Help
Entry
SM2011_c00262     CDS       T02497                                 

Definition
(GenBank) Putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00071  Fatty acid degradation
smel00072  Synthesis and degradation of ketone bodies
smel00280  Valine, leucine and isoleucine degradation
smel00310  Lysine degradation
smel00362  Benzoate degradation
smel00380  Tryptophan metabolism
smel00620  Pyruvate metabolism
smel00630  Glyoxylate and dicarboxylate metabolism
smel00640  Propanoate metabolism
smel00650  Butanoate metabolism
smel00900  Terpenoid backbone biosynthesis
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01120  Microbial metabolism in diverse environments
smel01130  Biosynthesis of antibiotics
smel01200  Carbon metabolism
smel01212  Fatty acid metabolism
smel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SM2011_c00262
   00630 Glyoxylate and dicarboxylate metabolism
    SM2011_c00262
   00640 Propanoate metabolism
    SM2011_c00262
   00650 Butanoate metabolism
    SM2011_c00262
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SM2011_c00262
   00072 Synthesis and degradation of ketone bodies
    SM2011_c00262
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM2011_c00262
   00310 Lysine degradation
    SM2011_c00262
   00380 Tryptophan metabolism
    SM2011_c00262
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SM2011_c00262
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SM2011_c00262
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SM2011_c00262
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smel04147]
    SM2011_c00262
Enzymes [BR:smel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SM2011_c00262
Exosome [BR:smel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM2011_c00262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt HMG_CoA_synt_N DAO_C
Motif
Other DBs
NCBI-ProteinID: AGG74274
Position
complement(1830135..1831304)
Genome map
AA seq 389 aa AA seqDB search
MTKAQIVGWAHSQFGKTDHADTEALMAAVAAPALAHAGLAASDVDGIFVGVMNGGFSKQE
FQGALVGMTDEALAHVPSVRLENACATGSAAIYTAMDFIEAGRGRIALVIGAEKMTAVPT
AEVGDILLGGSYRKEEADVEGGFAGVFGRIAQHYFQRYGDRSEELAMIAAKNHANGVANP
YAHMRRDFGFAFCNTVSEKNPIVAAPLRRTDCSLVSDGAAALVLADADTAATLQRAIAFR
ARSHVNDVFALSRRDMLEFDGPRRAWKAALSMAGATLGDLSFVETHDCFTIAEMIEYEAM
GLTAPGEGYRAIRDGTTTRSGSLPVNPSGGLKSKGHPIGATGVSMHVISAMQLMEEAGEM
QIPGAGLAGIFNMGGAAVANYVSILERAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcgcagatcgtaggctgggcccactcccagttcggcaagaccgaccacgcg
gacacagaggcgctgatggccgcggttgcggcgccggcacttgcccatgccggtcttgcc
gcctcggatgtcgacggcatctttgtcggagtcatgaatggcggcttctccaagcaggag
tttcagggcgcacttgtcggcatgaccgacgaggcgctcgctcatgtcccgtccgtgcgc
ctcgaaaacgcctgcgcgacaggctcggcggcgatctataccgcgatggatttcatcgag
gccggccgcggccgcatcgcgctcgtcatcggcgccgaaaaaatgaccgccgttccgacg
gcagaggtcggcgacatccttctgggcggcagctacaggaaagaggaggccgacgtcgaa
ggcggttttgcgggcgtcttcggccgcattgcacagcattacttccagcgttacggcgat
cgttccgaggaacttgcgatgatcgcggccaagaaccacgcgaacggcgtagccaaccct
tacgcgcatatgcgcagggatttcggttttgcgttctgcaacaccgtttccgagaagaat
ccgatcgtcgcggctcccttgcgccgcaccgactgctcgctcgtatcggacggggcggca
gccctcgtgctcgccgacgcggacacggctgcgacgctgcagcgggcaatcgccttccgg
gcccgcagccacgtcaacgacgtgtttgcgctcagccgccgggacatgctggaattcgac
gggccacggcgggcatggaaagcggccctttccatggccggcgccacgctgggcgatctc
tccttcgtcgagacgcatgactgcttcaccatagccgagatgatcgaatacgaggcgatg
ggcctgaccgcacccggcgaaggctaccgtgcgatccgcgacggcaccaccaccagaagc
ggaagcttgccggtcaatccctccggcggcttgaaatcgaagggtcatccgatcggtgcg
acgggggtctcgatgcatgtcatctccgccatgcagcttatggaggaggcgggcgaaatg
cagatccccggcgccggtctcgccggtatcttcaacatgggcggcgctgccgtcgcaaac
tatgtctccatcctggaacgggcgaaatga

DBGET integrated database retrieval system