KEGG   Sinorhizobium meliloti 2011: SM2011_c02135Help
Entry
SM2011_c02135     CDS       T02497                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
smel  Sinorhizobium meliloti 2011
Brite
KEGG Orthology (KO) [BR:smel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SM2011_c02135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGG73100
Position
complement(577656..578048)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIIIANHSGLAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFDVAIPAFSL
DSPGLVRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcgctgacacgcgacatcgaagtgacggtcgagccgtactacctggaagaa
cagtcggatcccgacgacagccgctatgtctggggctatcgcatcatcatagcgaaccat
tccggactcgcggtccggctgatgacccgctactggcacattaccgacgagaacggtcag
gtggacgaggtgagcggccccggcgtgatcggcgagcagccgctgctcaatcccggcgat
acctacgagtactcctccggctgcccgctggatacaccctccggcgtgatgttcggccat
tacagcatggaggcggaaggcggggagactttcgatgtcgccatccccgccttctcgctc
gattcgccgggcctcgtccgcacgcttaattga

DBGET integrated database retrieval system