KEGG   Sinorhizobium meliloti 2011: SM2011_c03206Help
Entry
SM2011_c03206     CDS       T02497                                 

Gene name
maiA
Definition
(GenBank) Maleylacetoacetate isomerase (glutathione transferase zeta 1) protein
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00350  Tyrosine metabolism
smel00643  Styrene degradation
smel01100  Metabolic pathways
smel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SM2011_c03206 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    SM2011_c03206 (maiA)
Enzymes [BR:smel01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     SM2011_c03206 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_4 GST_C
Motif
Other DBs
NCBI-ProteinID: AGG75526
Position
complement(3170836..3171489)
Genome map
AA seq 217 aa AA seqDB search
METGVANETVLYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAKAHRAPEHLARNPQGLV
PVLDIDGERLTQSLAIIEYLAETRDGTGLLPAHPIDRQRVRALSYAVAMDIHPVCNLGVV
ARVMAGAGDGEAARREWMQKFIGEGLAAFERMLDHPATGAFCHGDRPTMADLCLVPQVYN
ARRWDVDLAACPLLVAIDRRCAGIDAFQRAHPDRAKP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgggtgtggcgaacgaaaccgtgctttacgactattggcgctcgtcggcgagc
taccgggtgcggatcgccctcaacctgtgcggcgaagcctatcgctccgtcccggtcgac
ctgctcgcaaaggctcatcgcgcgccggagcatctcgcccggaatccgcagggattggtg
ccggtgctcgacatcgacggcgagcgcctcacccagtcgctcgccatcatcgaatatctt
gcggagacgcgggatgggacgggtctcctcccggcccatcccatcgaccggcaacgcgtc
cgcgcgctttcctatgccgtggcgatggatatccatcccgtctgcaatctcggcgtggtc
gcccgtgtgatggcgggcgcgggcgacggcgaggccgcgcggcgcgagtggatgcagaaa
ttcatcggcgagggtctcgctgccttcgagcgtatgctggaccaccccgcgaccggtgca
ttctgccatggcgatcgtccgacgatggcggatctctgccttgtgccccaggtctacaat
gcgcggcgctgggatgtcgatcttgcggcctgcccgcttctggtcgccatagatcgccgc
tgcgccggcatcgacgccttccagagggcgcatcccgaccgcgcaaaaccttag

DBGET integrated database retrieval system