KEGG   Sinorhizobium meliloti 2011: SM2011_c03834Help
Entry
SM2011_c03834     CDS       T02497                                 

Gene name
pcbD
Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00790  Folate biosynthesis
smel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SM2011_c03834 (pcbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smel04147]
    SM2011_c03834 (pcbD)
Enzymes [BR:smel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     SM2011_c03834 (pcbD)
Exosome [BR:smel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM2011_c03834 (pcbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGG75816
Position
complement(3503853..3504167)
Genome map
AA seq 104 aa AA seqDB search
MRPEKLDAAAIAEHLHKMEGWVLAEDGGSIWKTFRFKTFAEAFTFMTQCAFAAEKLNHHP
EWFNVYNKVDVTLSTHDADGLTELDFKLAAKMDQAAEGRMPDHM
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgcggccggaaaaattggacgcggcggccatcgccgagcacttgcacaagatggagggc
tgggtccttgcggaggatggcggctcgatatggaagaccttccggttcaagactttcgcc
gaggccttcaccttcatgacgcaatgcgccttcgccgccgaaaagcttaatcatcatccg
gaatggttcaacgtctacaacaaggtggacgtgacgctctcgactcacgacgcggatgga
ctgaccgaactcgatttcaagttggcggcaaagatggaccaggcggcggagggccgcatg
cccgaccatatgtaa

DBGET integrated database retrieval system