KEGG   Sinorhizobium meliloti 2011: SM2011_c04029Help
Entry
SM2011_c04029     CDS       T02497                                 

Definition
(GenBank) Putative low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
smel  Sinorhizobium meliloti 2011
Pathway
smel00260  Glycine, serine and threonine metabolism
smel01100  Metabolic pathways
smel01110  Biosynthesis of secondary metabolites
smel01120  Microbial metabolism in diverse environments
smel01130  Biosynthesis of antibiotics
smel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SM2011_c04029
Enzymes [BR:smel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SM2011_c04029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC DUF5130 Aminotran_1_2 FliC_SP
Motif
Other DBs
NCBI-ProteinID: AGG75403
Position
3031582..3032628
Genome map
AA seq 348 aa AA seqDB search
MIFSSDNWAGAHPAIAESLVANAQGYASAYGTSELDRRVEQRFSEIFERDVAVFFVGTGT
AANSLALSSANRAGGIAFCHREAHVNVDECGAPEFFSHGARLCPVEGARGRMEPAKLEAE
IRRLPRENVHGGQPMAVTLTQATESGTVYSLDQIETIGSIARSHKLPLHMDGARFANALV
SLGTTPAEMTWKRGVDLLSFGGTKNGCWCAEALVLFDLSKAQEMHFLRKRSAQLFSKSRF
VAAQFDAYLAGDLWLDLARHANAMAQRLADGITASAGSRLAWAPDANEVFVVLKREAAGR
LQRQGALFYDWEVPHDLEGSLAEDEGLYRLVTSFATRAEDVDRFVAAC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctcctccgacaactgggccggcgcccatccggcgattgccgaaagtctggtc
gcgaatgcgcagggctatgcttccgcctacggcacgagcgaactcgaccggagggtggaa
cagagattttcggagattttcgagagggacgtcgcggtattcttcgtgggcaccggaacc
gccgcaaattcccttgcgctttcgagcgccaatcgggcgggcggaatcgctttctgccat
cgcgaagcgcatgtgaacgtcgacgagtgcggcgcgccggagttcttctcgcacggcgcg
aggctgtgcccggtcgagggcgcccgcggcaggatggagccggcgaagctcgaggccgaa
attcggcggctcccgagggagaacgtccatggcggtcagccgatggcggtgacgctgacg
caggcgaccgagagcggcaccgtctattcgctcgaccagatcgaaacgatcggttcgatc
gcccgctcccataaactgccgctgcacatggatggcgcccgtttcgccaatgccctggtc
agccttggtacgacaccggccgagatgacctggaagcgtggcgtcgatctgctttcgttc
ggcggaaccaagaacggctgctggtgcgccgaggcgctggtgctcttcgacctttcgaag
gcgcaggagatgcacttcctgcgcaagcgctcggctcaactcttctccaagtcgcgcttc
gtcgccgcccagttcgacgcctatcttgccggcgatctctggctcgatcttgcgcgccac
gccaacgcgatggcacagcgcctcgccgacggcatcaccgcttcggccgggagccggctt
gcctgggcgcccgatgccaacgaggtcttcgtcgtgctgaaacgggaggccgcgggtcgg
ctgcagcggcagggcgcgcttttctacgattgggaagtgccgcacgatctcgaaggcagc
ctcgcggaagacgaagggctctatcgcctggttaccagcttcgccacccgcgccgaggac
gtcgaccgtttcgtcgccgcctgctga

DBGET integrated database retrieval system