KEGG   Sinorhizobium meliloti RMO17: DU99_01925Help
Entry
DU99_01925        CDS       T03395                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00770  Pantothenate and CoA biosynthesis
smer01100  Metabolic pathways
Module
smer_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DU99_01925
Enzymes [BR:smer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     DU99_01925
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     DU99_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AIL98212
UniProt: A0A222GNH7
Position
complement(403446..404651)
Genome map
AA seq 401 aa AA seqDB search
MTLSGKRILLIISGGIAAYKSLDLIRRLRERGADVRPVMTAAAQRFVTPLTVGAISASHV
FTELFAREDEQDVGHIRLARHCDLVVVAPATADLMAKMAHGHADDLASTVLLATDRPVLL
APAMNPRMWSHPATLRNRATLAGDGVRFVGPATGEMAESGEAGEGRMAEPLEIVAAVEEL
FSEARPLAGRKAIVTSGPTHEPIDPVRYIANRSSGKQGHAIAAALARLGAEVTLVSGPVT
IADPAGVRVVRVERAEEMRDAVLAALPADVAVMVAAVADWRVASTAGNKIKKRPGEAPPP
LQLAENPDILKTVGHYASRPRLVIGFAAETENVAENGRAKLQKKGADYILANDVSPATGI
MGGDRNRVKLIGRDGTEEWPEMGKDDVAAKLAALIVAKLSS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacactgtcgggcaagcgcattcttctcatcatctccggcggcatcgcggcctataag
agcctcgatctgatccgccgcctgcgcgagcgcggcgccgacgtgcgcccggtgatgacg
gcggcggcgcagcgtttcgtgacgccgctgaccgtcggcgcgatctcggcctcccacgtt
ttcacggagcttttcgcgcgcgaggacgagcaggatgtcggtcacatccggctggcgcgg
cattgcgatctcgtggtcgtggcgccggcaacggccgacctgatggcaaagatggcgcac
ggtcacgccgacgacctcgcctcgacggtgctcctggcgaccgaccggccggtgctgctc
gcgccggcgatgaacccgaggatgtggtcgcaccctgccacgctccgcaaccgcgcgacg
ctcgccggcgacggcgtccgcttcgtcggacctgccaccggcgaaatggccgagagcggc
gaggcaggggaaggccgcatggccgaacctctggagatcgtcgcggcggtcgaggaattg
ttcagcgaggcaaggccgctcgccgggcgcaaggccatcgtcacatccggaccgacgcac
gagccgatcgatccggtgcgctacatcgccaaccgctcgtccgggaagcagggccacgcg
atcgccgcagcactggcacggctcggcgccgaggtcacgctcgtttccgggccggtgacg
atcgcggaccccgccggcgtccgcgtcgtccgggtcgagcgcgccgaggagatgcgtgat
gcggtgttggccgcgctgccggccgatgtggccgtcatggtggcggccgttgccgactgg
cgcgtcgcatcgacagccggcaacaagatcaagaagcggccgggagaagcccctcctccg
ctgcagcttgccgagaatcccgatatcctgaagaccgtcggccactacgcatcgcggccg
aggctcgtgatcggctttgccgccgagaccgagaacgtcgccgagaacggccgcgccaag
ctccagaagaagggcgccgattacattctggccaacgacgtttcgcccgcaaccggcatc
atgggcggcgaccgcaatcgcgtgaagcttatcggccgtgacggcaccgaggaatggccg
gaaatgggcaaggacgatgtcgcggcgaagctcgcagcgctgatcgtggcgaagctttca
tcctga

DBGET integrated database retrieval system