KEGG   Sinorhizobium meliloti RMO17: DU99_04570Help
Entry
DU99_04570        CDS       T03395                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00071  Fatty acid degradation
smer00072  Synthesis and degradation of ketone bodies
smer00280  Valine, leucine and isoleucine degradation
smer00310  Lysine degradation
smer00362  Benzoate degradation
smer00380  Tryptophan metabolism
smer00620  Pyruvate metabolism
smer00630  Glyoxylate and dicarboxylate metabolism
smer00640  Propanoate metabolism
smer00650  Butanoate metabolism
smer00900  Terpenoid backbone biosynthesis
smer01100  Metabolic pathways
smer01110  Biosynthesis of secondary metabolites
smer01120  Microbial metabolism in diverse environments
smer01130  Biosynthesis of antibiotics
smer01200  Carbon metabolism
smer01212  Fatty acid metabolism
smer02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DU99_04570
   00630 Glyoxylate and dicarboxylate metabolism
    DU99_04570
   00640 Propanoate metabolism
    DU99_04570
   00650 Butanoate metabolism
    DU99_04570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DU99_04570
   00072 Synthesis and degradation of ketone bodies
    DU99_04570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DU99_04570
   00310 Lysine degradation
    DU99_04570
   00380 Tryptophan metabolism
    DU99_04570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DU99_04570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DU99_04570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DU99_04570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smer04147]
    DU99_04570
Enzymes [BR:smer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DU99_04570
Exosome [BR:smer04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DU99_04570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIL98712
Position
complement(962724..963917)
Genome map
AA seq 397 aa AA seqDB search
MNASSDPARTPVVIAALRTPVGRVNGSLAAVEPARLAALLIERIIADTGIDRAEIDDVLV
GNAANSAGNLARLAALEAGLPVAIPGVTVDRQCGSGLEAIVLAARQIQAGAGRFYLAGGT
ESASRAHIRLRPPLTRGEEPQPVKRARMAPDSIGDPDMGVAAENVATACGISRERQDRFA
LESHRRAVAAEAEGRFSREIVPVPTPEGPIARDECPRANASAETLSRLRPVFVAGGTVTA
GNACPVNDGAAMVLMTNLAEARKLGTRFGLAFTDAATAGVEPKLLGLGPVPAMAKLRARN
PALDVARVDFIEFNEAFASQVLGSLDQLDIAPERVNRDGGAIALGHPYGASGAILVVRLF
SQMLAASSPAEGLAMMGIGGGMGIAAHFSSCRPDQAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcctcgtctgaccccgctcgcaccccggtcgttatcgccgcgctgcggacgccg
gtcggccgcgtcaacggcagccttgctgcggtcgaaccggcacgccttgccgccttgctg
atcgaaaggatcattgcggatacgggcatcgaccgggcagagatcgacgacgtgctcgtc
ggtaatgccgccaacagtgccggcaatctcgcgcgcctggccgcgctcgaggcaggattg
cccgtcgcaattccgggcgtcaccgtcgaccgtcaatgcggttcggggctggaggcgatt
gtccttgcggcccggcagatccaggccggcgcggggcgcttctaccttgccgggggcacc
gagagcgccagtcgcgcccatatccgccttcggcccccgctcacgcgcggcgaagagcct
cagccggtcaagcgcgcgcggatggctcccgactcgatcggcgatccggatatgggcgtt
gcggcggagaacgtcgcgactgcctgcggcatctcgcgtgagcggcaggatcgttttgcg
ctcgaaagccaccgacgcgccgttgcggccgaagcggagggccggttctcgcgcgagatc
gtgcccgtgccgacaccagaggggccgatcgcgagggacgaatgtcctcgcgcaaacgcc
tctgccgagacgctctcgcgactgaggccggttttcgttgccggcggcaccgtcaccgcc
ggaaatgcctgcccggtcaatgacggcgcggcgatggtactgatgacgaacctcgcggag
gcgcggaagctcggtacgcgcttcggcctcgctttcaccgatgctgcgacggccggcgtc
gaaccgaagctgctcggcctcggccccgtccccgccatggcgaagcttcgcgcgcgcaat
cccgcgctcgatgtggcccgcgtcgatttcatcgaattcaacgaggcctttgcctcgcag
gttctcgggagcctcgaccagctcgatatcgcacccgaacgcgtcaatcgcgacggcggc
gcgatcgcgctcggccacccctatggcgcttccggcgccattctcgtcgtccggctgttt
tcgcagatgttggcggcttcatccccggccgaggggctggccatgatgggcatcggcggc
ggcatggggatcgccgcccacttcagcagctgcagaccggatcaggcggcatag

DBGET integrated database retrieval system