KEGG   Sinorhizobium meliloti RMO17: DU99_05765Help
Entry
DU99_05765        CDS       T03395                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:smer00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DU99_05765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smer01007]
    DU99_05765
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smer03016]
    DU99_05765
Enzymes [BR:smer01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     DU99_05765
Amino acid related enzymes [BR:smer01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   DU99_05765
Transfer RNA biogenesis [BR:smer03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    DU99_05765
 Prokaryotic Type
    DU99_05765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 DUF982 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIL98934
UniProt: A0A222K8Y8
Position
1197118..1198518
Genome map
AA seq 466 aa AA seqDB search
MGGMPILKLYNTLTREKADFRPIDPQNVRMYVCGPTVYDYAHIGNARPIIVFDVLFRLLR
HVYGADHVTYARNITDVDDKINARALRDYPGLPLNEAIRHVTEKTETQFLEDATVLGCLD
PTVQPRATENIAGMIEIIEKLIAKGHAYEAEGEVLFDTRSMDDYGQLSKRNLDEQQAGAR
VAVEAHKKNPGDFVLWKLSAEHEPGWDSPWGRGRPGWHIECSAMSGRYLGDVFDIHGGGI
DLIFPHHENEIAQSRCAHGTEVMANVWMHNGFLQVEGRKMSKSEGNFITIYELLHTEKFG
GRKWPGEVLRLAMLMTHYREPIDFSIKRLEEAEHLLSKWPVYGDAAGEADPAVVTALADD
LNTVAAIQALHALAQKASADSRHLGTFAASAALLGVVPKEVELDEAVVHEIDGRVRERLE
LLKAKNYAEADGIRADLLARGIQLKDGKDPETGERVTTWEVKRSQV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaatgccgattttgaagctgtacaacacgctgacgcgggaaaaggccgatttt
cggccgatcgaccctcaaaacgtccgcatgtatgtctgcggcccgacggtctacgactac
gcccatatcggcaatgcacggccgatcatcgtcttcgacgtcctgttccggctgcttcgt
cacgtctatggcgcggatcacgtcacctatgcccgcaacatcaccgatgtggacgacaag
atcaacgcgcgggcattgcgcgactatcccgggctgccgctgaacgaggcgatccgtcat
gtgaccgagaagaccgagacgcaattcctcgaagatgcgactgtgctcggttgcctggat
cccaccgtgcaaccgcgcgcgaccgaaaacatcgccgggatgatcgagatcatcgaaaag
ctgatcgccaagggccatgcctacgaggccgagggggaagtcctcttcgatacgcggtcg
atggacgattacggccagctctccaagcgcaatctcgacgagcagcaggccggtgcccgc
gtcgccgtcgaagcgcacaagaaaaacccgggcgatttcgtgctctggaagctctccgcc
gagcacgagccgggctgggatagcccctggggtcgcgggcgacccggctggcacatcgaa
tgctcggcgatgagcgggcgctatctcggcgacgtcttcgacatccacggcggcggcatc
gacctgattttcccgcatcacgagaacgagatcgcccagtcgcgttgcgcccacggcacc
gaggtgatggcgaatgtctggatgcacaacggcttcctgcaggtcgaaggccgcaagatg
tcgaagtccgagggcaattttatcaccatctacgagcttcttcacacggaaaaattcggc
ggccgcaaatggccgggcgaggtgcttcggctggcgatgctgatgacccattaccgcgaa
ccgatcgacttctcgatcaagcggctggaggaggccgagcatctgctgtcgaaatggccg
gtttacggcgacgctgcaggcgaggcggacccggccgtcgtcaccgccctcgcggacgac
ctcaataccgtggccgccattcaggcgctgcatgcgctggcgcaaaaggcttccgccgac
tcgcgccatctcgggaccttcgccgcgagcgcggcgcttctcggcgtggtgccgaaggag
gtcgaactcgacgaggcggtcgttcacgagatcgacggccgtgtacgtgagcgcctggag
cttctgaaggccaagaactacgcggaggccgacggcatccgtgccgatctcctggccaga
ggcatccagctcaaggacggcaaggatcccgagaccggcgaaagagtgaccacctgggag
gtgaagcggtctcaggtctag

DBGET integrated database retrieval system