KEGG   Sinorhizobium meliloti RMO17: DU99_07585Help
Entry
DU99_07585        CDS       T03395                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smer  Sinorhizobium meliloti RMO17
Pathway
smer00010  Glycolysis / Gluconeogenesis
smer00020  Citrate cycle (TCA cycle)
smer00620  Pyruvate metabolism
smer01100  Metabolic pathways
smer01110  Biosynthesis of secondary metabolites
smer01120  Microbial metabolism in diverse environments
smer01130  Biosynthesis of antibiotics
smer01200  Carbon metabolism
Module
smer_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DU99_07585
   00020 Citrate cycle (TCA cycle)
    DU99_07585
   00620 Pyruvate metabolism
    DU99_07585
Enzymes [BR:smer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DU99_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 HlyD_2 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AIL99271
UniProt: A0A222I2H5
Position
1547421..1548764
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAVPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAGAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctccccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaagatcgtc
gttcccgccggcactgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgag
ggcgaagacgtcgcgactgccgccaagggcggcaacggtgcagcgggagcagtcccggca
ccgaagccgaaggaaacggccgaaacggcaccggccgcggctccggcacccgccgcagcg
ccggcaccgcaagctgctgctccggcttctcctgcgcccgccgatggcgaaggcaagcgc
atcttttcgtcgccgctggcacgccgcctcgcgaaggaggcaggcatcgacctttcggcg
atcgccggttccggaccgcatggccgcgtcgtcaagaaggacgtcgagacagccgtttcc
ggtggcgccgccaagcccgccggcgcgccggcagcagctccggccccggcgacgctcgct
aagggcatgtcggaggacgccgtcctcaagctcttcgagccaggctcctacgaactcgtg
ccgcatgacggcatgcgcaagacgatcgccaagcgcctcgtcgaatcgaagcagacgatc
ccgcatttctatgtttcggtcgattgcgagctcgacgcgcttatggcgctgcgcgcccag
ctgaatgccgcagcacctgaaaaggatggtaagccggtctacaagctttccgtgaacgac
atggtgatcaaggcgcttgctctggcgctgcgcgacgttccggatgcgaatgtgtcctgg
accgatcagaacatggtcaagcacaagcacgcggacgtcggcgtggccgtctccatcccc
ggcggcctgatcacgcccatcgtccgccaggcggagttgaagagcctctcggcgatctcc
aacgagatgaaggatctcggcaagcgcgcgaaggagcgcaagctgaagccggaagaatat
cagggcggcaccacggccgtctccaatatgggcatgatgggcgtcaaggacttcgccgcc
gtcgtcaatccgccgcacgcgacgatcctcgcggtcggcgccggcgaggaccgtgtcgtc
gtcaggaacaaggaaatggtcatcgccaatgtgatgaccgtcacgctttcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcgccgccttcaagcgctacatcgaa
aacccgatgggtatgctcgtctga

DBGET integrated database retrieval system