KEGG   Streptobacillus moniliformis: Smon_0483Help
Entry
Smon_0483         CDS       T01125                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00230  Purine metabolism
smf01100  Metabolic pathways
Module
smf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Smon_0483
Enzymes [BR:smf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Smon_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 dNK Cytidylate_kin AAA_22 AAA_17 ABC_tran KTI12 PRK AAA_5 AAA_16 Thymidylate_kin Pox_VLTF3 NTPase_1 AAA_29 AAA T2SSE AAA_21 RsgA_GTPase MMR_HSR1 AAA_28 RNA_helicase AAA_30 Zeta_toxin Gcw_chp RNase_PH DUF3987
Motif
Other DBs
NCBI-ProteinID: ACZ00963
UniProt: D1AXD7
Position
564756..565301
Genome map
AA seq 181 aa AA seqDB search
MKGKLFIVSGPSGSGKSTVTKLVRDMLNIPLAISVTTRQIRTGEVDGKDYYFITKEEFEK
KINENGLFEYANVHGNYYGTLNSEIEKHLENGQNVILEIDVQGGVIAKNKRNDSILIFFK
APSLEELEKRLRGRNTDSEKVIKKRLENALKELEYEKDYDYTIINYDIEDSCKQLINIIE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaagttattcatagtttcaggaccatcaggttctggaaaatcaactgttaca
aaactagtaagagatatgttaaatatacctttagcaatttctgtgactactcgtcaaatt
agaactggagaagttgatggtaaagattattactttataactaaagaagaatttgaaaag
aaaattaatgaaaatggattatttgaatatgcaaatgttcatggtaattattatggtact
ttaaattctgagattgaaaaacatttagaaaatggtcaaaatgttattcttgaaatagat
gtacaaggtggagttatagctaaaaataaaagaaatgactctattttaatattctttaaa
gctcctagtcttgaagaattagaaaaaagattaagaggaagaaatacagatagtgaaaaa
gtaataaagaaaagattagaaaatgctcttaaagaacttgaatatgaaaaagattatgat
tatacaataattaattatgatattgaagattcttgtaagcagcttattaacatcatagag
gactaa

DBGET integrated database retrieval system