KEGG   Streptobacillus moniliformis: Smon_0884
Entry
Smon_0884         CDS       T01125                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
smf  Streptobacillus moniliformis
Pathway
smf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smon_0884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smf02044]
    Smon_0884
Enzymes [BR:smf01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smon_0884
Secretion system [BR:smf02044]
 Type IV secretion system
  Trb secretion system protein
   Smon_0884
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 ABC_tran Zot TraG-D_C AAA_29 DUF87 AAA_21
Other DBs
NCBI-ProteinID: ACZ01351
UniProt: D1AYH5
Position
complement(973927..976458)
AA seq 843 aa
MLKQILNDYKKSYKFFIHFETMIEDGIILNKNNGFQSTFKVRFYDLDYLSTDDITTINDR
LNNAYKRLPDGFSIHFEVQRNKSDKYPTKDLKNKPYPTRIIDKMRENSVTKETFYSTEYF
VTLTYIMQNDSNEKINLLLNKFTSIFSKNKEKENTKDELIKIFKNELKEYKDQILMFIEQ
VKTAAIDVEMLKGEELLAFLYTAINMEKREKVKVPKDNIMLLDEYLTVSTLTNGEYTKIN
DEYVKVVTINMFPDNVTQRIFNQLESLNFEYRYVTRFIMLSREETIKILKDFKVYFSAKV
KSFAQWLIEIKNGQEVQNIDYTALDKVDEADLALNEAKTGALAYGYYTFSFIIKDKNLEN
LDKKVNDVRKILNFYDFVAGEDKYNTLDSIFGALPGNIVNNVRKSPMNTYLLSALLPMSS
LYVGNKVNKHLKDIALFTTKTDKELFYFNLHNKDIGHSLVIGPTGAGKSFLLSMIAANFL
KYEGKILDKEGKEKIKPSQVFFFDKDASSRVLTYTSGGKFYDLGEKEIAFQPLKNIHINS
EKEWALGWIIGILEQEGIPYDATTKNIVEQSIESLTTAKIESRTLSNLRTYIASRSKTVA
QALDSYCGENVYGEYFDNNFDNITDNNFITFEMGNVISNPKVVAPLLDYIFHKIEREKLD
GTPTLILLDECWLFLKNEKMREKINEWLKVLRKKNTSVVFATQSLSDIADSPIFSTIIDA
CKTNIFLPNERAMSAWVDLYKRFNLTEKEIKEINDGTMKQDYFVKTTEGARLFQLNPSDI
EIAYLGSSTSNDQNIIINLKNKIDDEILSNNEKIKKLNREWLSYKYKIGEISINNINQIK
DIL
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgttaaaacagatattaaatgactataaaaaatcatataaattttttattcattttgaa
actatgattgaagatggaataatattaaataaaaataatggttttcaatctacatttaaa
gtaagattttatgatttagattatttaagtacagatgatataacaacaataaatgataga
ttaaataatgcttataaaagattaccagatggattttcaatacattttgaagtacagaga
aataaaagtgataaatatccaactaaagatttaaaaaataagccttaccctacaaggata
atagataaaatgagagaaaattctgtaactaaagaaacattttattcaacagaatacttt
gttactcttacatatataatgcaaaatgatagtaatgaaaaaataaatttattattaaat
aaatttacaagtatattttcaaaaaataaagaaaaagaaaatactaaagatgaattaatt
aagatatttaaaaatgaactaaaagaatacaaagatcaaatattaatgtttattgaacaa
gttaaaactgctgcaattgatgttgaaatgttaaaaggagaagagctattagcttttcta
tacactgcaataaatatggaaaaaagagaaaaagtaaaagttcccaaagataatattatg
ttgcttgatgaatacttaactgtatcaactttaacaaatggagaatatactaaaataaat
gatgaatatgttaaagtagttacaattaatatgtttccagataatgtaactcaaagaata
tttaatcaacttgagagtttaaattttgaatatagatatgtaactagatttattatgtta
agtagagaagaaacaattaaaattttaaaagattttaaagtatatttttctgctaaagta
aaatcttttgcacagtggttaatagaaattaaaaatgggcaagaagttcaaaatatagat
tatacagcacttgataaggttgacgaggcagatttagcattaaatgaagctaaaactgga
gcattagcttacggatattatacattttcatttattattaaagataaaaatttagaaaat
ttagataaaaaagttaatgatgttagaaaaatacttaatttctatgattttgtagctgga
gaagataaatacaatacactagattctatttttggagctttacctggtaatattgtaaat
aatgttagaaaatcgcctatgaatacttatttattgtcagcattattacctatgtcctct
ttatatgtaggaaataaggtaaataaacacttaaaagatattgccttatttactactaaa
actgataaggaactattttattttaaccttcacaataaagatattggacatagtttggtt
ataggacctactggtgctggtaaatcattcttacttagtatgatagcagctaatttctta
aaatatgaaggaaaaatattagataaagaaggaaaagaaaaaataaaaccatctcaagta
tttttctttgataaagatgcttcaagtagagtacttacatatacatctggtggaaaattc
tatgatttaggagaaaaagaaatagcttttcaaccattaaagaatatacatataaatagt
gagaaggagtgggctttaggttggattattggaatacttgagcaagaaggaatcccttat
gatgctactactaaaaatatagtggaacaatctatagaatcacttacaactgcaaaaatt
gaaagtagaacattatcaaatttaagaacatatattgcatctcgttcaaaaactgtagca
caagcactagattcatattgtggagaaaatgtttatggagaatattttgataataatttt
gataatattactgataataattttattacatttgaaatgggtaatgtaatttctaatcca
aaagttgtagcaccattattagattatatatttcataaaatagaaagagaaaaattagat
ggaacacctacacttatcttacttgatgaatgttggcttttcttaaaaaatgaaaaaatg
agagaaaaaattaatgaatggcttaaagtattaagaaagaaaaatacatcagttgtattt
gcgacacaatctttatcagacattgctgattctcctatattctcaactataattgatgct
tgtaaaacaaatattttcttacctaatgaaagagctatgagtgcttgggtagatttatat
aagagatttaacttaacagaaaaagagataaaagagataaatgatgggacaatgaaacaa
gattactttgttaagactacagaaggtgcaagattatttcagttaaatccttcagatatt
gaaatagcttatttgggttcttcaacaagtaatgatcaaaatattataattaatttaaaa
aataagattgatgatgaaatattatctaataatgaaaaaattaaaaaattaaatagagaa
tggttaagttataaatacaaaataggagagataagtataaataatataaatcaaataaaa
gatattttataa

DBGET integrated database retrieval system