KEGG   Streptobacillus moniliformis: Smon_1186
Entry
Smon_1186         CDS       T01125                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
smf  Streptobacillus moniliformis
Pathway
smf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smon_1186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smf02044]
    Smon_1186
Secretion system [BR:smf02044]
 Type IV secretion system
  Trb secretion system protein
   Smon_1186
SSDB
Motif
Pfam: TrbI DUF5345 DUF2207 DUF2721
Other DBs
NCBI-ProteinID: ACZ01641
UniProt: D1AV81
Position
complement(1306067..1307464)
AA seq 465 aa
MKEKNIAISVLERMNYHLDILNNQMYNVSDEEISEVKANLILDTEELVDNIKKMEEIVNK
VNQNNENKTLEKENIKEEIIREEKTNSLKNLKILFGIIALILLSIVSITIYKNVPKIEEV
EEIEIADPNSFRITENDTTDEDKPFEKIEDIEDTNFEKIIEDTIKDKDKKHEEVNLEKNI
SEAEVSNLDENRVEKDHEELDRAIAELENRSHVNEVLGKKNSVEGLTFIRKSKENDDKKK
EITRNRYKLNEEVENKVENIIDRKNKIASSFNDYLVQQGSVIPAIFLTEVNTDLPGSVLA
QVRENVYDSRTGNYLLIPKGSKLYGRYESNVSKGQTRVFMVWDKLSLPNGKYIELSEFHA
GDNLGNSGVSDKTNNHTWSLIGNAVLSSVLNFTDTLASGVSFNLGGLKIGLNGQSKDGKD
TSPFKEVTSHLVKKEVERQPTITIRRGYKFNIIVNGDMELEKYKY
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaaggaaaagaatatagctatttctgtcttagagcgaatgaattatcatttagatata
ttaaataatcaaatgtataatgtcagtgatgaagaaatttctgaagttaaagcaaatcta
atattagatacagaagaattagttgataatataaagaaaatggaagaaattgttaataag
gttaatcaaaacaatgaaaataagactttagaaaaagaaaatataaaagaagagataatt
agagaagaaaaaacaaactcattaaaaaacttaaaaattctatttggaatcatagcttta
atactattatcaattgttagtataacgatttataaaaatgtacctaaaattgaagaagtg
gaagaaatagaaatagctgatccaaatagctttagaataactgaaaatgatacaacagat
gaagataaaccttttgaaaaaatagaagatattgaagatactaattttgaaaaaattatt
gaagatactattaaagataaagataaaaaacatgaagaagttaatcttgaaaaaaatata
agtgaagctgaagtaagtaatttagatgaaaatagagttgaaaaagaccatgaagagctt
gatagagctatagcagaacttgaaaatagatcgcatgttaatgaagtattgggcaagaaa
aactcagtggagggattaacctttataagaaaaagtaaagaaaatgacgataagaaaaaa
gaaataactagaaatagatataagcttaatgaagaagtagaaaataaggttgaaaatata
attgatagaaaaaataagatagcttcttcatttaacgattatttagtacaacaaggttcg
gtaatacctgcaatatttttaacagaagttaatacagatttacctggtagtgttttagca
caagttagagaaaatgtctatgatagtagaactggaaattacttattaattcctaagggt
tcaaaactttatggtagatatgaaagtaatgtatctaaaggtcagactagagttttcatg
gtatgggataaattatcattacctaatgggaaatatatagaattatcagaatttcatgct
ggagataatttaggtaattcaggagttagtgataaaactaataatcatacatggtcttta
ataggaaatgcagtactttcaagtgttttaaattttacagatactttagcaagtggagtt
agttttaatttaggtggtttaaaaattggattaaatggacaatctaaagatgggaaagat
acatctccatttaaagaagttacatcacatttagtaaaaaaagaagtagaaagacaacca
actataacaataagaagaggatataaatttaatattatagttaatggagatatggaactt
gaaaaatataaatattaa

DBGET integrated database retrieval system