KEGG   Streptobacillus moniliformis: Smon_1247Help
Entry
Smon_1247         CDS       T01125                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
smf  Streptobacillus moniliformis
Pathway
smf00520  Amino sugar and nucleotide sugar metabolism
smf01100  Metabolic pathways
smf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smon_1247
Enzymes [BR:smf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Smon_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ACZ01700
UniProt: D1AVE0
Position
complement(1377916..1379067)
Genome map
AA seq 383 aa AA seqDB search
MIIKNARIFDGDKFIPENVVILSGNRIEKITTVSELNDELMSKHEIVDIEGKVLSPGFID
LQINGCGGVLFNDEITVKTLEIMNETNKKYGCTSFLPTLITSPDEKILKALELINEIKDT
KEEIGVLGLHIEGPYISVEKKGVHRPDYIRVLDDKVIDEIAKIGYDGVKIITVAPENALV
KHLKLLKESGINIALGHTNATYAQIEEKSEYFTHATHFFNAMRGFDSREPGAVGYLLDKK
NVQCGIIVDGLHASFPSVRVVKEVMRSNLYLVTDAVSPMGTDMKEFIFEGHLVRHENGKC
WDPKTGSLGGSALDMITGVKNLIKEVKVSEEEALRMATSYPAKAVQVDDRYGYIKEGYIA
DLTFYNSDYKVEGTISKGKLQRY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgataatcaaaaatgctagaatatttgatggagataaatttattcctgaaaatgtggta
atacttagtggaaataggattgaaaaaataacgacagtatcagaacttaatgatgaatta
atgtctaagcatgaaatagtagatatagaaggtaaagttctttccccaggatttatagat
ttacaaattaatggttgtggaggagtactgtttaatgatgaaattactgtaaaaacatta
gaaatcatgaatgaaactaataaaaaatatggttgtacttcttttttacctacattgatt
acatctccagatgaaaaaatattaaaagctttagaattaataaatgaaattaaagatact
aaagaagaaataggggtgttaggactacatattgaaggaccatatataagtgtggagaaa
aaaggtgtccatagaccagactatattagagtattagatgataaagttatagatgagata
gctaagataggttatgatggagttaaaataataacagtagctccagaaaatgctttagtt
aaacatctaaaacttttaaaagaaagtggaataaatatagctttagggcatactaatgct
acatatgctcaaatagaagaaaaatctgaatactttactcatgctacacatttctttaat
gctatgcgtggttttgattcaagagaaccaggagctgtaggttatctgctagataagaag
aatgtgcaatgtggaattatagtagatggattacatgcaagtttcccatcagttagagta
gtaaaagaagttatgagatcaaatctatatttagttacagatgcagtatctcctatggga
acagatatgaaagagttcatatttgaaggtcatttagttagacatgaaaatggtaaatgt
tgggaccctaaaacaggttcattaggtggttcagcactagatatgattacaggagttaag
aatttaattaaagaagttaaagttagtgaggaagaagcacttcgtatggcaacttcatat
ccagctaaagcagttcaagttgatgatagatatggatatattaaagaaggatatattgca
gatttaactttctataattcagattacaaagtagaaggaacaatttcaaaaggtaaatta
caaagatattaa

DBGET integrated database retrieval system