KEGG   Sinorhizobium meliloti Rm41: BN406_00153Help
Entry
BN406_00153       CDS       T02332                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
smi  Sinorhizobium meliloti Rm41
Brite
KEGG Orthology (KO) [BR:smi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN406_00153 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CCM66198
Position
complement(163805..164197)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIIIANHSGLAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFDVAIPAFSL
DSPGLVRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcgctgacacgcgacatcgaagtgacggtcgagccgtactacctggaagaa
cagtcggatcccgacgacagccgctatgtctggggctatcgcatcatcatagcgaaccat
tccggactcgcggtccggctgatgacccgctactggcacattaccgacgagaacggtcag
gtggacgaggtgagcggccccggcgtgatcggcgagcagccgctgctcaatcccggcgat
acctacgagtactcctccggctgcccgctggatacaccctccggcgtgatgttcggccat
tacagcatggaggcggaaggcggggagactttcgatgtcgccatccccgccttctcgctc
gattcgccgggcctcgtccgcacgcttaattga

DBGET integrated database retrieval system