KEGG   Sinorhizobium meliloti Rm41: BN406_00429Help
Entry
BN406_00429       CDS       T02332                                 

Definition
(GenBank) Putative phosphate permease HP_1491
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smi  Sinorhizobium meliloti Rm41
Brite
KEGG Orthology (KO) [BR:smi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN406_00429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCM66474
Position
complement(443854..445359)
Genome map
AA seq 501 aa AA seqDB search
MAKPRPRLEKLTLDKDLDKFSLAEEASHHVMRRLAAPGLAALFLILSMGFAASYFTGASG
AAVVVAAAAVAGYMAMNIGANDVTNNVGAAVGAKAISMPVALGIAAVFEIAGALIAGRKV
TLTIEAGIIDGTQLVGAEGLVWVMLSALISSAIWINIATYSRAPVSTTHSLIGGIIGAGV
AAAGLSSVKWWAIAGITASWTISPVLGGVIAALFLAFLKEFVIYRDDKISAARRWMPVVL
GVTAGSFTAYVAVFAIDHLAFVPLPTGLSIGGLAGIACYIVSKPWIHRQSEGLENRNQSL
RKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVSAVDGVISSADSEAPFWVLLIGALG
ISVGLLLYGPLLIRVVGEEITRLNPMRAFCVALATAVTVLLASALGLPISSTHTAVGAVF
GVGFFREWYTRHSQRRLEYVRRKTGQTEFMEKGETNFAEVRRRRLVRRSHFLTIVAAWVI
TVPVSALLSAFLYLVLSGLFL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagccgcgaccgcgcctcgaaaagctgacgctcgacaaggatctcgacaagttc
agccttgccgaggaagcgtcgcatcacgtcatgcgcaggttggctgctcccgggcttgcc
gctctcttcctgatcctcagcatgggcttcgcggcgagctatttcacgggcgcctccggt
gcggccgtggtggtggcggctgcggcggtcgcgggctacatggcgatgaacatcggcgcc
aacgacgtcaccaacaacgtcggagcggcggtcggtgcaaaagcgatatcgatgcccgtg
gcgctggggattgcggcggtgttcgagatcgccggagcgctgatcgccggccgtaaggtc
acgctgaccatcgaggccgggatcatcgacggcacgcagctggtcggcgccgaggggctg
gtctgggtgatgctgtcggcgcttatctcatcggcgatctggatcaatatcgcgacctat
tcgcgtgcgcccgtttcgacgacgcattcgctcatcggcggcattatcggcgcaggtgtc
gccgccgccgggctttccagcgtcaagtggtgggcgatcgccggcatcacggcgagctgg
acgatttcgcccgtgctcggcggggtcattgccgcactcttcctcgccttcctcaaggag
ttcgtcatctaccgcgatgacaagatctcggccgcccggcgctggatgcctgtcgtcctc
ggcgtcaccgccggttcgttcacggcctatgtcgcggtctttgccatcgatcatctggct
tttgtcccgcttccgaccggcctgtcgatcggcgggctggccgggatcgcttgctacata
gtgtcgaagccgtggatccaccgccagtcggaaggtctcgaaaaccgcaaccagtcgctt
cgcaagctgttccgcctgccgctcatcttctcggccgccctgctgtccttcgcccatggc
gcaaacgacgtatcgaacgcgatcggcccgctgtcggcgatcgtctcggccgtcgacggc
gtgatctcgagcgcggattcggaggcccccttctgggtactcctcatcggcgcactcggc
atctcggtgggtcttctgctctacggtccgctgctgatccgtgtcgtcggcgaggagatc
acgcgcctcaatccgatgcgcgccttctgcgtggcgcttgcgaccgccgtgacggttctg
cttgcctcggctctcggcctgccgatcagttccacccacacggcggtgggcgccgtcttc
ggcgtcggcttctttcgcgagtggtacacgcgccactcgcaacggcggctcgaatatgtc
cggcgcaagacgggccagaccgaattcatggaaaagggcgagacgaattttgcggaagtg
cgtcgccggcgcctggtgcggcgctcccacttcctgacgatcgtcgccgcctgggtcatc
acggttcccgtgtcggcgctgctctcggccttcctctatctcgtcctctccggcctgttt
ctctag

DBGET integrated database retrieval system