KEGG   Sinorhizobium meliloti Rm41: BN406_00541Help
Entry
BN406_00541       CDS       T02332                                 

Gene name
vraB
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00071  Fatty acid degradation
smi00072  Synthesis and degradation of ketone bodies
smi00280  Valine, leucine and isoleucine degradation
smi00310  Lysine degradation
smi00362  Benzoate degradation
smi00380  Tryptophan metabolism
smi00620  Pyruvate metabolism
smi00630  Glyoxylate and dicarboxylate metabolism
smi00640  Propanoate metabolism
smi00650  Butanoate metabolism
smi00900  Terpenoid backbone biosynthesis
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
smi01212  Fatty acid metabolism
smi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN406_00541 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_00541 (vraB)
   00640 Propanoate metabolism
    BN406_00541 (vraB)
   00650 Butanoate metabolism
    BN406_00541 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    BN406_00541 (vraB)
   00072 Synthesis and degradation of ketone bodies
    BN406_00541 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN406_00541 (vraB)
   00310 Lysine degradation
    BN406_00541 (vraB)
   00380 Tryptophan metabolism
    BN406_00541 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN406_00541 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN406_00541 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN406_00541 (vraB)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN406_00541 (vraB)
Exosome [BR:smi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN406_00541 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCM66586
Position
complement(568669..569862)
Genome map
AA seq 397 aa AA seqDB search
MNASSDPARTPVVIAALRTPVGRVNGSLAAVEPASLAALLIERIIADTGIDRAEIDDVLV
GNAANSAGNLARLAALEAGLPVAIPGVTVDRQCGSGLEAIVLAARQIQAGAGRFYLAGGT
ESASRAHIRLRPPLTRGEEPQPVKRARMAPDSIGDPDMGVAAENVATACGISRERQDRFA
LESHRRAVAAEAEGRFSREIVPVPTPEGPIARDECPRANASAETLSRLRPVFVAGGTVTA
GNACPVNDGAAMVLMTNLAEARKLGARFGLAFTDAATAGVEPKLLGLGPVPAMAKLRARN
PALDVARVDFIEFNEAFASQVLGSLDQLDIAPERVNRDGGAIALGHPYGASGAILVVRLF
SQMLAASSPAEGLAMMGIGGGMGIAAHFSSCRPDQAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcctcgtctgaccccgctcgcaccccggtcgttatcgccgcgctgcggacgccg
gtcggccgcgtcaacggcagccttgctgcggtcgaaccggcaagccttgccgccttgctg
atcgagaggatcattgcggatacgggcatcgaccgggcagagatcgacgacgtgctcgtc
ggtaatgccgccaacagtgccggcaatctcgcgcgcctggccgcgcttgaggcaggattg
cccgtcgcaattccgggagtcaccgtcgaccgtcaatgcggttcggggctggaggcgatt
gtccttgcggcccggcagatccaggccggcgcggggcgcttctaccttgccgggggcacc
gagagcgccagtcgcgcccatatccgccttcggcccccgctcacgcgcggcgaagagcct
cagccggtcaagcgcgcgcggatggctcccgactcgatcggcgatccggatatgggcgtt
gcggcggagaacgtcgccactgcctgcggcatctcgcgtgagcggcaggatcgttttgcg
ctcgaaagccaccggcgcgccgttgcggccgaagcggagggccggttctcgcgcgagatc
gtgcccgtgccgacacctgaggggccgatcgccagggacgaatgtcctcgcgcaaacgcc
tctgccgagacgctctcgcgactgaggccggttttcgttgccggcggcaccgtcaccgcc
ggaaatgcctgcccggtcaatgacggcgcggcgatggtactgatgacgaacctcgcggag
gcgcggaagctcggtgcgcgcttcggcctcgctttcaccgatgctgcgacggccggcgtc
gaaccgaagctgctcggcctcggccccgtccccgccatggcgaagcttcgcgcgcgcaat
cccgcgctcgatgtggcccgcgtcgatttcatcgaattcaacgaggcctttgcctcgcag
gttctcgggagcctcgaccagctcgatatcgcacccgaacgcgtcaatcgcgacggcggc
gcgatcgcgctcggccacccctatggcgcttccggcgccattctcgtcgtccggctgttt
tcgcagatgttggcggcttcatccccggccgaggggctggccatgatgggcatcggcggc
ggcatggggatcgccgcccacttcagcagctgcagaccggatcaggcggcatag

DBGET integrated database retrieval system