KEGG   Sinorhizobium meliloti Rm41: BN406_01180Help
Entry
BN406_01180       CDS       T02332                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00010  Glycolysis / Gluconeogenesis
smi00020  Citrate cycle (TCA cycle)
smi00620  Pyruvate metabolism
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
Module
smi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_01180 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BN406_01180 (pdhC)
   00620 Pyruvate metabolism
    BN406_01180 (pdhC)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN406_01180 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: CCM67225
Position
1200827..1202170
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAAEGEDVATAAKGGNGAAGAAPAPKPKETAETAPAAAPAPAAA
PAPQAAAPASPAPADGEGKRIFSSPLARRLAKEAGIDLSAIAGSGPHGRVVKKDVETAVS
GGAAKPAAAPAAAPAPATLAKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRLVESKQTI
PHFYVSVDCELDALMALRAQLNAAAPEKDGKPVYKLSVNDMVIKALALALRDVPDANVSW
TDQNMVKHKHADVGVAVSIPGGLITPIVRQAELKSLSAISNEMKDLGKRAKERKLKPEEY
QGGTTAVSNMGMMGVKDFAAVVNPPHATILAVGAGEDRVVVRNKEMVIANVMTVTLSTDH
RCVDGALGAELLAAFKRYIENPMGMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggccctctctccgaccatggaagaaggcaatctggcc
aagtggctggtcaaggaaggcgacaaggtcaagtccggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtggaagccgtcgatgagggcacggtcgccaagatcgtc
gttcccgccggcaccgaaggcgtcaaggtcaatgcgctgatcgcggttctcgccgccgag
ggcgaagacgtcgcgactgccgccaagggcggcaacggtgcagcgggagcagccccggca
ccgaagccgaaggaaacggccgaaacggcaccggccgcggctccggcacccgccgcagcg
ccggcaccgcaagctgctgctccggcttctcctgcgcccgccgatggcgaaggcaagcgc
atcttttcgtcgccgctggcacgccgcctcgcgaaggaggcaggcatcgacctttcggcg
atcgccggttccggaccgcatggccgcgtcgtcaagaaggacgtcgagacagccgtttcc
ggtggcgccgccaagcccgccgccgcgccggcagcagctccggccccggcgacgctcgct
aagggcatgtcggaggacgccgtcctcaagctcttcgagccgggctcctacgaactcgtg
ccgcatgacggcatgcgcaagacgatcgccaagcgcctcgtcgaatcgaagcagacgatc
ccgcatttctatgtttcggtcgattgcgagctcgacgcgcttatggcgctgcgcgcccag
ctgaatgccgcagcacctgaaaaggatggtaagccggtctacaagctttccgtgaacgac
atggtgatcaaggcgcttgctctggcgctgcgcgacgttccggatgcgaatgtgtcctgg
accgatcagaacatggtcaagcacaagcacgcggacgtcggcgtggccgtctccattccc
ggcggcctgatcacgcccatcgtccgccaggcggagttgaagagcctctcggcgatctcc
aacgagatgaaggatctcggcaagcgcgcgaaggagcgcaagctgaagccggaagaatat
cagggcggcaccacggccgtctccaatatgggcatgatgggcgtcaaggacttcgccgcc
gtcgtcaatccgccgcacgcgacgatcctcgcggtcggcgccggcgaggaccgtgtcgtc
gtcaggaacaaggaaatggtcatcgccaatgtgatgaccgtcacgctttcgaccgaccat
cgctgcgtcgatggcgcgctcggcgccgaactgctcgccgccttcaagcgctacatcgaa
aacccgatgggtatgctcgtctga

DBGET integrated database retrieval system