KEGG   Sinorhizobium meliloti Rm41: BN406_02582Help
Entry
BN406_02582       CDS       T02332                                 

Gene name
ylyB
Definition
(GenBank) putative RNA pseudouridine synthase YlyB
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
smi  Sinorhizobium meliloti Rm41
Brite
KEGG Orthology (KO) [BR:smi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smi03009]
    BN406_02582 (ylyB)
Enzymes [BR:smi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BN406_02582 (ylyB)
Ribosome biogenesis [BR:smi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BN406_02582 (ylyB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: CCM68627
Position
2647204..2648235
Genome map
AA seq 343 aa AA seqDB search
MNDPFKQAPGNRKVLTAGDDAAGRLDAFLTEALAGEFSRNRIKSLIEQGAVSINGATVTE
PKRKVHPGDSFRIALPEPEDPEPKGEAIPLDVLYEDADLIVLVKPAGLVVHPGAGNWTGT
LVNALIHHCGDSLSGIGGVKRPGIVHRLDKDTSGVMVVAKNDAAHRHLSDQFADHGRNGP
LERAYRAVVWGRPRQLKGKIDAPLGRAGDRTKRAVKREDSDDAREAITHYEVVERYHEKP
DGTSLASTVECHLETGRTHQIRVHMAHIGHPLIGDPDYGAAFRTKANLLPEPARAAVNRF
PRQALHAFMLQFEHPATGETMHFETPVPADMQELIAALRAGAP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccctttaaacaagcgcccggcaataggaaagtcctgacggcaggcgatgac
gcggccgggcgcctcgacgccttcctgacggaagcgcttgcgggcgagttttcgcgcaat
cgcatcaagagcctgatcgagcaaggagccgtctcgatcaacggcgcgaccgtcaccgaa
ccgaagcgaaaggttcatcccggcgactccttccggattgcactgcccgagccggaggat
cccgaacccaagggtgaggcgatcccgctcgacgtgctttacgaggatgccgacctgatc
gtactggtcaagccggccggtctggtcgtgcatccgggcgccggcaattggacgggaacc
ctcgtcaacgcgctcatccaccattgcggcgacagcctttccggcatcggcggcgtcaag
cgccccggtatcgtgcatcgcctcgacaaggacacgagcggcgtcatggtggtcgcgaag
aacgatgccgcacaccgccacctttcggatcagttcgccgaccatggccgcaacgggccg
ctcgagcgcgcctatcgcgccgtagtctggggccggccgcgccaattgaagggcaagatc
gacgcaccgctggggcgggcgggcgaccggacgaaacgggccgtcaaacgcgaagacagc
gacgatgcacgcgaggcgatcacgcattacgaggtggtcgagcgctatcacgagaaaccg
gacggcacctctctcgcctccaccgtcgagtgccatctggagaccgggcgtacgcaccag
atccgcgtgcacatggcccatatcggtcatccgctcatcggcgatccggattacggcgcg
gccttccgcaccaaggccaatctgctgccggaaccggcgagggccgccgtcaatcgcttt
ccgcgacaggccctgcacgccttcatgctgcaattcgaacaccccgcaaccggcgagacc
atgcatttcgaaacgcccgtgccggcggatatgcaggaattgatcgcggcgctgcgggcc
ggagccccttga

DBGET integrated database retrieval system