KEGG   Sinorhizobium meliloti Rm41: BN406_02958Help
Entry
BN406_02958       CDS       T02332                                 

Gene name
proB1
Definition
(GenBank) Glutamate 5-kinase 1
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00330  Arginine and proline metabolism
smi00332  Carbapenem biosynthesis
smi01100  Metabolic pathways
smi01130  Biosynthesis of antibiotics
smi01230  Biosynthesis of amino acids
Module
smi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BN406_02958 (proB1)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BN406_02958 (proB1)
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BN406_02958 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCM69003
Position
3077452..3078633
Genome map
AA seq 393 aa AA seqDB search
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgagaattaccgccgggtcgtcatcaagatcggctcg
gcactcctcgtcgaccgcaggaccgggctgaagaagagctggctcgacgcgctctgcgcc
gacattgcggccctcagggccaagggcgtggaagtgctcgtcgtctcctcgggagcgatt
gcgcttggacgcacggtgctcgacctgccggcgggtgcgctgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctcgacc
catgcgatcgtcgccggccagatcctcctgacgctgggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggtcagcttctgaagctcggctcggtgccgatcatc
aacgagaacgacacggtcgcgaccacagaaatccgctatggcgacaacgaccggctggca
gcgagggtcgcgaccatggtcggcgccgatctcctggtcctgctctcggatatcgacggg
ctctataccgcgccgccgcatctcgatccgaacgcccgtttcctcgaaacggtcgccgaa
atcacgcccgaaatcgaggcgatggcgggcggcgctgcctccgagctttcgcgcggcggc
atgcgcaccaagatcgacgccggcaagatcgcaaccactgccggctgcgcgatgatcatc
gcctccggcaagccggatcatccgctggccgcgatcgaggcgggcgcgcgctcgtcctgg
ttcgcgccatcaggctctccggtgaccgcccgcaagacctggatcgccggacagctcctg
ccggccggttcgctctcgatcgatgccggagcggaaacggcgctgcgttccggcaagagc
ctgctgccggccggcgtccggcaggtgacgggaagcttcagccgcggcgatacgattgcg
ataatcggcgcttccggccgcgagatcgcccgcggtcttgccggctacgatgccgacgag
gcgcgccagatcgccggcaagaagtcggccgagatcgccgccatcctcggctatgccggc
cgcaccgccatggtgcatcgcgacgatctggtcatgacggctccatcgggcgcgcgcctt
gtagaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system