KEGG   Sinorhizobium meliloti Rm41: BN406_03063Help
Entry
BN406_03063       CDS       T02332                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00071  Fatty acid degradation
smi00072  Synthesis and degradation of ketone bodies
smi00280  Valine, leucine and isoleucine degradation
smi00310  Lysine degradation
smi00362  Benzoate degradation
smi00380  Tryptophan metabolism
smi00620  Pyruvate metabolism
smi00630  Glyoxylate and dicarboxylate metabolism
smi00640  Propanoate metabolism
smi00650  Butanoate metabolism
smi00900  Terpenoid backbone biosynthesis
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
smi01212  Fatty acid metabolism
smi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN406_03063 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_03063 (phbA)
   00640 Propanoate metabolism
    BN406_03063 (phbA)
   00650 Butanoate metabolism
    BN406_03063 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN406_03063 (phbA)
   00072 Synthesis and degradation of ketone bodies
    BN406_03063 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN406_03063 (phbA)
   00310 Lysine degradation
    BN406_03063 (phbA)
   00380 Tryptophan metabolism
    BN406_03063 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN406_03063 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN406_03063 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN406_03063 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smi04147]
    BN406_03063 (phbA)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN406_03063 (phbA)
Exosome [BR:smi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN406_03063 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCM69108
Position
complement(3181797..3182978)
Genome map
AA seq 393 aa AA seqDB search
MSNPSIVIASAARTAVGSFNGAFGNTLAHELGAAAIKAVLERAGVEAGEVDEVILGQVLP
AGEGQNPARQAAMKAGLPQEKTAWGMNQLCGSGLRAVALGMQQIATGDAKVIVAGGMESM
SMAPHCAHLRGGVKMGDYKMIDTMIKDGLTDAFYGYHMGITAENVARKWQLTREEQDEFA
LASQNKAEAAQKAGRFADEIVPFVVKTRKGDVNVDQDEYIRHGATLDSIAKLRPAFDKEG
TVTAGNASGLNDGAAAALLMTEAEAARRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWSVADIELVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGVSKGLATLCIGGGMGVAMCVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccctcgatcgtcatcgccagcgcggctcgcacggccgtcggctccttcaac
ggcgccttcggcaatactctcgcgcacgaactgggtgcggccgccatcaaggcggtgctg
gagcgggctggcgtcgaagcgggcgaggtggacgaggtgatcctcggtcaggtgctgccg
gcgggcgaggggcagaatcctgcgcggcaagcggcgatgaaggccggtctcccgcaggaa
aagaccgcctggggcatgaaccagctttgcggctcgggcctgcgcgccgtagcgctcggc
atgcagcagatcgcaaccggcgatgcgaaggtcatcgttgccggcggcatggagtcgatg
tcgatggcgccgcattgcgcgcacctgcgcggcggcgtgaagatgggcgactacaagatg
atcgacacgatgatcaaggacggcctgacggatgccttctacggctaccacatgggcatc
accgccgagaacgttgcgcggaaatggcagctgacgcgcgaggaacaggacgaattcgcg
cttgcctcccagaacaaggcggaagcggcccagaaggccggccgtttcgccgacgagatc
gtgcctttcgtcgtgaagacgcgcaagggcgacgtaaacgtggatcaggacgagtacatc
cgccacggtgccacgctggattcgatcgcaaagctccgcccggccttcgacaaggaaggt
actgtgaccgcgggcaacgcttcgggtctcaacgacggtgccgccgcggcgctcttgatg
accgaggccgaggcggcccggcgcggcatccagccgcttgcccgcatcgtctcctgggcc
acggcaggcgtcgacccgcagatcatgggcaccggccccatccccgcatcgcgcaaggcc
ctcgaaaaggccggctggtcggtcgccgatatcgagctcgtggaggcgaacgaggctttc
gcggctcaggcctgcgccgtcaacaaggacctcggctgggatccttcgatcgtcaacgtc
aatggcggagcgatcgccatcggccatccgatcggtgcctccggtgcccgcgtgctgaac
acgcttcttttcgaaatgaagcggcgcggcgtctccaaggggcttgccaccctgtgcatc
ggcggcggcatgggcgtcgccatgtgcgtggaacgcctgtaa

DBGET integrated database retrieval system