KEGG   Sinorhizobium meliloti Rm41: BN406_03469Help
Entry
BN406_03469       CDS       T02332                                 

Gene name
gshB
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00270  Cysteine and methionine metabolism
smi00480  Glutathione metabolism
smi01100  Metabolic pathways
Module
smi_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BN406_03469 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN406_03469 (gshB)
Enzymes [BR:smi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BN406_03469 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CCM69514
Position
3646844..3647791
Genome map
AA seq 315 aa AA seqDB search
MAGIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDKLSLRDGRVYATAQQM
QLRDVRGDHFTLGEDERIDLSTMDVILLRQDPPFDMAYITSTHLLERLHPKTLVVNDPAW
VRNSPEKIFVTEFPDLMPKTLITRDPDEIARFRQEMGDIILKPLYGNGGAGVFHSARDDR
NFSSLLEMFAQMFREPYIAQEYLPAVRKGDKRILLVDGEPVGAINRVPAEHDSRSNMHVG
GRAEATDLTAREREICTRIGPALKERGFLFVGIDVIGDYLTEINVTSPTGIREVKKFGGA
DVASLLWDAIEKKRA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatcgtcaatgtcggggtccagatggaccatgtttcgggcatcaccattgcg
ggcgattcgaccttcgcgatgagccttgaggcgcaggcccgaggctatcgcctgttccac
tacacgcccgacaagctgtcgctccgggacggcagggtctatgcgaccgcgcagcagatg
cagttgcgcgacgtcaggggcgaccacttcactctcggcgaagacgagcggatcgatctt
tcgaccatggacgtcatcctgcttcgccaggatccgccattcgacatggcctatatcacc
tcgacgcatctcctcgagcggctgcacccgaagacgctggtcgtcaacgatccggcctgg
gtcaggaactcgcccgagaagatcttcgtgaccgagtttccggatctgatgccgaagacc
ctgatcacgcgcgacccggacgagatcgcccgcttccgtcaggagatgggcgacatcatc
ctgaaaccgctctacggcaatggcggcgccggtgtgttccactccgcgcgtgacgaccgc
aatttctcgtcgctcctcgaaatgttcgcccagatgttccgcgagccttatatcgcccag
gaatatctgccggcggtccgcaagggcgacaagcgcatcctgctcgtcgacggcgagccg
gtcggcgcgatcaatcgcgttccggccgagcacgattctcgctccaacatgcatgtgggc
gggcgcgcggaggcaaccgacctgacggcccgcgagcgggagatctgcacccgcatcggg
ccggccctgaaggaacgcggtttcctcttcgtcggcatcgacgtgatcggcgactacctg
accgagatcaacgtcacgtcgccgaccggcatccgcgaagtgaagaagttcggcggtgcc
gacgtcgctagcctgctctgggacgcgatcgagaagaagcgcgcctga

DBGET integrated database retrieval system