KEGG   Sinorhizobium meliloti Rm41: BN406_03635Help
Entry
BN406_03635       CDS       T02332                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BN406_03635
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BN406_03635
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BN406_03635
    1.1.1.-  
     BN406_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Exo_endo_phos ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: CCM69917
Position
pSYMA:140723..141736
Genome map
AA seq 337 aa AA seqDB search
MKAVRLYGAMDLRVGEVAEPSAPPPGFVNLEVRAAGICGSDLHNYRTGQWISRRPSTAGH
EFCGRVTAIGEGVSHVVRGDVVSADSRMWCGTCPACTSGRSNVCETLGFVGEICDGGFAE
AVQLPARLVVRHDPQLSPHVAAMAEPLAVALHAVRRLAIPAGEPVLVIGCGTIGGLSALL
LSRLHDGPLLLGDLNADKAALVAEVTGGAVVALDRAVVEAALSGGRVRYALDATGSIQAI
ARALDILSGGGALALVGIGHGKLDFDPNIIVEREISLVGCHAFAGELPEAIELLADLAPA
LQRFIEVLPTLDDVPEAYERLLRGESNALKTIIEVAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtgcggctttacggcgccatggatttgcgggtgggagaggtcgccgaaccg
tcggctccgccgccgggcttcgtcaaccttgaagtaagggctgctggcatctgcggttcc
gaccttcacaactaccgtaccggccaatggatctcgcgccggccctcgacggcaggccat
gaattctgcggtcgcgtgactgcgatcggagagggcgtcagtcacgtggtgcggggagac
gtcgtctcggcggactcacgcatgtggtgcggcacttgcccggcttgtacgagcggccgc
agcaatgtctgcgagaccttgggcttcgtcggcgagatttgtgacggcggctttgccgag
gcagtgcaattgccagcccgactggtcgtgcgccacgatccgcagctttcgccccatgtt
gccgccatggccgagccgctggcagtggccttgcatgccgtacgtcgccttgccattccg
gccggcgaaccggtcctcgtcatcggctgcggcacgatcggtgggttgagcgcgcttctt
ctgtcccggctgcatgatggtccgctgctgctcggcgatctgaacgccgacaaagccgcc
cttgtcgctgaggtgactggcggcgcggtcgttgctcttgacagggcggtggtcgaggcc
gcgctttccggcggaagggtgcgctatgcactggatgccaccggcagcatccaggcgatc
gcccgagctctcgacattctgtcaggcggcggagcgctggcgctcgtcggcatcggccac
ggcaagctcgatttcgatccgaacatcatagtggagcgggagatatcgctcgtcggctgt
catgcctttgcgggcgagttgcccgaggccatcgaattgctcgccgatctggcgccggcg
ctgcaacgtttcattgaggtgctgccgacgctcgacgatgtgccggaagcttatgaaagg
ctgctgcgaggcgagagcaatgcgctcaagacgatcatcgaggtggcgggctga

DBGET integrated database retrieval system