KEGG   Sinorhizobium meliloti Rm41: BN406_06279Help
Entry
BN406_06279       CDS       T02332                                 

Definition
(GenBank) putative ribulose bisphosphate carboxylase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00630  Glyoxylate and dicarboxylate metabolism
smi00710  Carbon fixation in photosynthetic organisms
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
Module
smi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BN406_06279
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN406_06279
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BN406_06279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CCM72561
Position
pSYMB:complement(1319088..1320362)
Genome map
AA seq 424 aa AA seqDB search
MQRALPVIRITYRIETPGDVEVLAKKIASDQSTGTFVPVPGETEELKARAAARVMAIRHL
EPADRASWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRVVD
MKLPPEFAAAHPGPQFGVAGSRRLTGVESRPIIGTIVKPALGLRPDETAVLVGDLLCCGV
DFIKDDEKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLV
VAAGGNAAVININSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRL
LGVDQFQINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYART
GHTTDLLYLCGGGIVSHPGGPSAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFAD
GKGA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagcgctgcccgtgatacgcatcacctaccgcatcgagaccccgggagatgtc
gaagtcctggcgaagaagatcgcaagcgaccagtcgaccggaacgttcgtgccggttccg
ggcgaaaccgaagagctgaaggcgcgggcggctgcgcgtgtaatggctatccggcacctc
gaacccgccgatcgggcatcatggccggatgaggcgggaagcgccacgcgcttcaaccgg
gccgatgcggagattgccttccccctcgatgcggtgggaacggatctttccgccttgatg
accattgcgatcggcggcgtctattccatcaagggaatgaccggcatccgcgtcgtggat
atgaagctgccgccggagttcgcggctgcgcatccgggtccgcagttcggcgttgccggc
agccggcgtctgaccggtgtcgaaagccgtccgatcatcggcactatcgtcaaaccggcg
ctgggtttgcggcccgacgaaaccgccgtactcgtcggcgacctgctttgttgcggggtg
gatttcatcaaggatgacgagaagttgatgagcccggcctattcgccgctgagtgcgcgg
atcgcagccatcatgccgagaatcctcgaccacgagcagaagaccggcaagaaggtcatg
tatgccttcgggatatcccataccgatccagacgagatgatgcgaaaccacgatctggtg
gtcgctgccggcggcaatgcggcggtcattaacatcaattccgtcggaatgggcggcgtc
gccttcctgcgcaagcgctccggcctcgtgctccacgcccatcgcaacggctgggatatt
ctcacgcgtcatggcggcttgggaatggaattttcggtctggcagcagttctggcggctc
ctcggggtggatcagttccagatcaacggcatccgcgtcaaatactgggagcctgacgag
agcttcgtgaagtccttcgaggcggtgagcacgccgctctttaccaaggacgattgtccg
ctgccggtcgtggggtcgggccaatggggcggacaggcgcccgagacctatgcacggacc
gggcacacgaccgatctgctctacctctgcggcggcggcatcgtcagccatccgggcgga
cccagcgccggcgtcagggccgtacgtcaggcctgggaggcggcagtcgccgggatcccg
ctggcggattatgccagggatcaccccgaactggcgcaatcgctcgaaaaattcgccgac
ggcaaaggcgcctga

DBGET integrated database retrieval system