KEGG   Sinorhizobium meliloti Rm41: BN406_06461Help
Entry
BN406_06461       CDS       T02332                                 

Gene name
cbbF
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00010  Glycolysis / Gluconeogenesis
smi00030  Pentose phosphate pathway
smi00051  Fructose and mannose metabolism
smi00680  Methane metabolism
smi00710  Carbon fixation in photosynthetic organisms
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
Module
smi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_06461 (cbbF)
   00030 Pentose phosphate pathway
    BN406_06461 (cbbF)
   00051 Fructose and mannose metabolism
    BN406_06461 (cbbF)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN406_06461 (cbbF)
   00680 Methane metabolism
    BN406_06461 (cbbF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smi04147]
    BN406_06461 (cbbF)
Enzymes [BR:smi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BN406_06461 (cbbF)
Exosome [BR:smi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN406_06461 (cbbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: CCM72743
Position
pSYMB:1512167..1513216
Genome map
AA seq 349 aa AA seqDB search
MSGATLEAYLASCTARGDDLSRDVAAVIQRLAKAALDIRKLVNQGALGTAFNGTHGGSNT
DGDLQKDLDILCDDQFLTCLQGAPVACYASEELENPVLLDPSARLAVAIDPLDGSSNIDN
NVSIGTIFSVLPAAKGPDVDPSQSFLQPGNRQLAAGFFIYGPQTALVLSLGKGTEIFIFS
SRLGCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDDCLAGSEGPRERDFNMRWI
ASLVAETYRILIRGGIFLYPADGRKGYSQGRLRLVYEANPIAFIIENAGGAATTSIDRIL
DLVPENLHQRVPLVFGSRREVARITRYHVDPNMIGERAPLFGKRGLFRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgcgactctcgaagcttacctcgcttcatgcacggcccgcggcgacgacctt
tcacgggacgtcgccgccgtgatccagaggctggcgaaggccgccctcgacatccgcaag
ctcgtcaaccagggagcgctcggtaccgctttcaacggcacccacggcggcagcaacacg
gatggcgatctgcagaaggatctcgacatcctgtgcgacgaccaattcctgacgtgtctg
caaggcgcccccgtcgcatgctacgcctcggaagaactggaaaatccggttctgctcgac
ccgtcggcgcgcctcgcagttgccatcgacccgctcgacggctcttcaaacatcgataac
aacgtttccatcggcacgatcttctcggtgcttcccgccgccaaggggccggacgtggac
ccctcccagtccttcctgcaacctggaaaccggcaactggcggcgggcttctttatctac
ggaccgcagaccgctctggtcctgtcgctcggcaaggggacggagatcttcatcttctcc
agcaggctcggatgtttcgtcgaggcctacaagtcggccatcatcccggagcgcgcgcac
gaattcgccatcaacatgtcgaactaccggcactgggaagaagcgatccggctctatgtc
gacgactgcctggcaggctccgagggcccgcgcgagcgggatttcaacatgcgctggatc
gcctcgctcgtcgcggaaacctatcgcatcctcatccgcggcgggatctttctctatccc
gccgacggccggaagggatatagccagggccggctgcggctcgtctacgaggccaacccg
atcgccttcatcatcgagaatgccggcggcgcggccaccacgtccatcgaccgcattctc
gatctcgttccggaaaatctgcaccagcgcgtgcctctggttttcggttcgcgccgcgag
gtggcgcgcatcacccgctatcacgtcgacccgaacatgattggcgaacgcgctccgctc
ttcggcaagcgcggtctgttccgggcctga

DBGET integrated database retrieval system