KEGG   Sinorhizobium meliloti Rm41: BN406_06464Help
Entry
BN406_06464       CDS       T02332                                 

Gene name
cbbA
Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00010  Glycolysis / Gluconeogenesis
smi00030  Pentose phosphate pathway
smi00051  Fructose and mannose metabolism
smi00680  Methane metabolism
smi00710  Carbon fixation in photosynthetic organisms
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
smi01230  Biosynthesis of amino acids
Module
smi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_06464 (cbbA)
   00030 Pentose phosphate pathway
    BN406_06464 (cbbA)
   00051 Fructose and mannose metabolism
    BN406_06464 (cbbA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN406_06464 (cbbA)
   00680 Methane metabolism
    BN406_06464 (cbbA)
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BN406_06464 (cbbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase HMGL-like SporV_AA
Motif
Other DBs
NCBI-ProteinID: CCM72746
Position
pSYMB:1516194..1517273
Genome map
AA seq 359 aa AA seqDB search
MARITLRQLLDHAAERSYGVPAFNINNMEQGLAIMEAARASDAPVILQVSRGARSYANDV
MLAKMMEALEEMYPDIPLCIHQDHGNNVATCLTAIQHGFTSVMMDGSLKEDAKTPADYDY
NVSITAEVSRLAHMVGASVEGELGCLGSLETGHGEAEDGHGFEGALDRSQLLTDPDEAAR
FVAETGVDALAVAIGTSHGAYKFTRKPTGEVLAMDVIEKIHERLPDTHIVMHGSSSVPQE
WQDVFNAHGGQMRETYGVPVEEIVRGIRFGVRKVNIDTDLRLAAAAAFRRVADTSRSEFD
PRKFLKPAMDAMSAVCKARFEAFGTAGNASRIKVVPMPEMARRYASGSLKPQSARSEAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcacgcttcgccaattgctcgatcacgccgccgaacgcagctatggcgtg
ccggcattcaacatcaacaacatggaacaggggcttgcgatcatggaggcggcgcgagcc
tcagatgctcccgtgatcctccaggtctcgcgtggcgcccgctcctacgcaaacgacgtc
atgctcgccaagatgatggaagctctggaagagatgtatccggacattccgctctgcatc
caccaggatcacggcaacaatgtcgcgacctgcctcacggcgatccagcacggattcacc
tcggtcatgatggacggctcgctgaaggaggatgccaagacccctgccgattacgactat
aacgtctcgatcacggcagaggtaagccgcctcgcgcacatggtcggcgcctcggtcgaa
ggcgagctcggctgcctcggatcgctcgagaccggccacggcgaggccgaggacggccac
ggctttgaaggcgcgctcgaccgttcgcaactgcttaccgatccggacgaagccgcccgc
ttcgtcgccgagaccggcgtcgatgcactggccgtcgccatcggcacctcgcacggggca
tacaagtttacccgcaagccgaccggcgaagtcctcgccatggacgtgatcgagaagatc
catgagcggctgccggacacccatatcgtgatgcacggctcctcctccgtgccgcaggaa
tggcaggacgttttcaacgcccatggcggccagatgcgcgagacctacggcgtccccgtc
gaggagatcgtacgtggcatccgcttcggcgtgcgcaaggtcaatatcgacaccgacctg
cgccttgccgcggccgctgcctttcgccgcgtcgccgacacgagccgcagcgaattcgac
ccgcgcaaattcctgaaacccgccatggacgccatgtcggcggtctgcaaggcccgtttc
gaggccttcggcaccgccggaaacgcatcccgcatcaaggtcgtgccgatgccggagatg
gcccgccgctacgcaagcggctccctgaaaccccagtctgcgcggtcggaagccgcctga

DBGET integrated database retrieval system