KEGG   Sinorhizobium meliloti Rm41: BN406_06526
Entry
BN406_06526       CDS       T02332                                 

Definition
(GenBank) dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00230  Purine metabolism
smi01100  Metabolic pathways
smi01120  Microbial metabolism in diverse environments
Module
smi_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN406_06526
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BN406_06526
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CCM72808
Position
pSYMB:complement(1578392..1580710)
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHENVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
DVDGGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDIAPSGHPI
VGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKAEPENLAIRDGFVVVTNGSNRSIRLSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLEVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIHDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgatagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgcgcatgcg
cgcatcaggagcatcgacacaagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgagaacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcg
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggtgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcacaatcgaagccgcatcggtgcccggcgccccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
gacgtcgacgggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcggc
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtccggtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggccgc
tgcatctataccaattcgccgatcgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgaccttatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgagggcgacatcgcaccctccgggcatccgatc
gtcggacacggcctcggggattgcatccgccgcgtcatggaggagacgaactggcacgaa
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacgctgatcaccggcaccgccggcctcggtaccggcgcgcat
acggcgctttcgcagatcgtcgccgaggagctcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaaggccgagcccgagaatctcgcgatccgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccggctttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactggtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtcgccgttctc
gaggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacag
atcgagggcggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgacggacgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcgccggatcccggcggtccctac
ggagccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atccacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system