KEGG   Sinorhizobium meliloti Rm41: BN406_06555Help
Entry
BN406_06555       CDS       T02332                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase LhgO
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00310  Lysine degradation
smi01100  Metabolic pathways
smi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    BN406_06555 (lhgO)
Enzymes [BR:smi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     BN406_06555 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_2 FAD_binding_3 FAD_binding_2 HI0933_like Pyr_redox_3 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CCM72837
Position
pSYMB:complement(1613787..1615034)
Genome map
AA seq 415 aa AA seqDB search
MYDYCIIGGGIVGLATAMALQERMGGASIVLLEKERELARHQTGHNSGVIHAGIYYAPGS
LKAKLCREGAEATKEFCTGNGISFETCGKLLVATNDAEIERMESLEERAQQNGIEYTRLS
KSQLRSDEPNIAGLGALLVHATGIVDYSAVCRAMAERIEVRGGEIRRGIEATAIAEEDGG
VRIASAIGRIEARRLIACAGLQSDRIALMAGLSIDHRIVPFRGEYYVLPASKAGVTRRLI
YPIPDPNLPFLGIHLTRTIDGGMTVGPNAVLGFAREGYPKGSFKAADVANMAAFPGFWKM
AAKNWRSAITEFANSASRFRYLRECRKYCPSLTIDDLAVPQAGIRAQAVMADGSLVNDFL
FKQTERMLHVCNAPSPAATSAIPIGRMIVDRLLDGAPPATERSQSLHGTHAQLHR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgactattgcatcatcggaggcgggatcgtcggtcttgcgaccgctatggcgctg
caggaaaggatgggcggcgccagcatcgtgcttctggaaaaggagcgggagcttgcgcgg
catcagacgggccacaacagcggtgtgatccacgccgggatttactatgcaccgggatcc
ctgaaagcgaagctgtgccgcgagggagcggaggccacgaaagaattctgcaccgggaac
ggcatatcgttcgaaacctgcggcaaattgctggtcgcgacgaacgatgccgagatcgag
cgcatggagagcctggaagaaagagcgcagcagaatgggatcgaatacactcgcctgtcg
aagtcgcaactgcgatcggacgagcctaacatcgccggcctcggtgcgcttctcgtccat
gcgacggggatcgtcgattattcggccgtttgccgggcgatggccgagcgcatcgaagtc
cggggcggcgaaatccggcgcgggatcgaggccactgccattgccgaagaggacggaggc
gtgcggatcgcaagtgcaatcggccgcatcgaagcgcgcaggctgatcgcctgcgccggc
ctgcagtccgaccgtatcgcgctcatggccggcctcagcatcgaccaccgcatcgttccg
ttccggggcgaatattacgtgttgccggcatcgaaggccggtgtgaccaggcgcctcatc
taccccattcccgacccgaacctgcctttcctcggaattcacctgacccggacgatcgac
ggaggcatgaccgtcggccccaatgcggtgctgggctttgcccgcgagggctacccgaag
ggcagcttcaaagcggccgatgtggcgaacatggcggcgtttcccggcttctggaaaatg
gcggcgaagaactggcgttcggcgatcacggaattcgccaattcggcatcgcggttccgc
tatctgcgggagtgccggaaatactgcccgtcgctcacgattgacgacctcgcggtcccg
caggccggcatccgggcgcaggcggtcatggccgacggcagtctcgtcaacgacttcctc
ttcaaacagaccgaaaggatgctccacgtctgcaacgcgccgtcgccggctgcgacctcg
gcaattccgatcggccgcatgatcgtcgatcgcctgctcgacggggctcctcccgcgacg
gaacgatcacaatcgcttcatgggactcatgcgcaacttcatcggtag

DBGET integrated database retrieval system