KEGG   Sinorhizobium meliloti Rm41: BN406_06665Help
Entry
BN406_06665       CDS       T02332                                 

Gene name
fda
Definition
(GenBank) Fructose-bisphosphate aldolase class 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00010  Glycolysis / Gluconeogenesis
smi00030  Pentose phosphate pathway
smi00051  Fructose and mannose metabolism
smi00680  Methane metabolism
smi00710  Carbon fixation in photosynthetic organisms
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
smi01230  Biosynthesis of amino acids
Module
smi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_06665 (fda)
   00030 Pentose phosphate pathway
    BN406_06665 (fda)
   00051 Fructose and mannose metabolism
    BN406_06665 (fda)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BN406_06665 (fda)
   00680 Methane metabolism
    BN406_06665 (fda)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smi04131]
    BN406_06665 (fda)
   03036 Chromosome and associated proteins [BR:smi03036]
    BN406_06665 (fda)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smi04147]
    BN406_06665 (fda)
Enzymes [BR:smi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BN406_06665 (fda)
Membrane trafficking [BR:smi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BN406_06665 (fda)
Chromosome and associated proteins [BR:smi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    BN406_06665 (fda)
Exosome [BR:smi04147]
 Exosomal proteins
  Proteins found in most exosomes
   BN406_06665 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic DUF2007
Motif
Other DBs
NCBI-ProteinID: CCM69602
Position
pRM41A:59582..60478
Genome map
AA seq 298 aa AA seqDB search
MADAKMMSQMTGKDGFIAALDQSGGSTPGALRLYGIAETDYSGDEAMFRLMHEMRVRIMT
APAFSGDKVIGAILFEKTMDGEVKGKPAPSYLWEDRGVVPFLKVDKGLAAEENGVQVMKP
MPDLDELLARAAKKGIFGTKMRSVIANADKAGITAVVEQQFEVGRQILGHGLVPIIEPEV
SIKSLTKEEAEAILREEIARQLDAVPAGEQVMLKLTIPTIPDFYKPLIAHKALARVVALS
GGYSRADACEKLSRNHGMIASFSRALTEDLRLAMSDAEFDASLGRTIDEIYTASAVKI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaaagatgatgtcacagatgactggcaaggacggcttcatcgctgccctc
gaccagagcggagggtccacccccggtgccctgcgcctatatggcattgccgaaaccgac
tacagcggtgacgaggcaatgttccgcctgatgcatgaaatgcgggtgcgcattatgacg
gcgcccgctttctccggcgacaaggtgatcggcgccatcctgttcgagaagaccatggac
ggcgaggtcaagggcaagccggctccctcttatctttgggaagaccgcggcgtggtgccc
ttcctcaaggttgacaaggggctggccgccgaggagaacggcgttcaggtgatgaagcct
atgcccgatctcgacgagctgctcgcccgcgccgcgaagaaaggcattttcggcaccaag
atgcgctcggtgatcgccaacgccgacaaggccggcatcaccgccgtggtggagcagcag
ttcgaggtgggccgtcagatcctcgggcacggcctcgtcccgatcatcgagccggaagtc
tcgatcaagagcctgacgaaagaggaggccgaggcgatcctgcgcgaagagatcgcccgc
caactcgatgcggtcccggcgggcgagcaggtcatgctcaagctcaccatcccgaccatt
ccggatttctacaagccgctgattgctcataaagcgctcgctcgcgtcgtggccctgtcg
ggcggctatagccgcgcggatgcctgcgaaaaactcagccgtaaccatggcatgatcgcc
agcttctcgcgtgcactaacggaggacctgcgcctggcgatgagcgacgccgagttcgac
gccagcctcggcaggacgatcgacgagatctacaccgcgagcgctgtgaagatctga

DBGET integrated database retrieval system