KEGG   Sphingosinicella microcystinivorans: SmB9_06130Help
Entry
SmB9_06130        CDS       T05811                                 

Definition
(GenBank) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00450  Selenocompound metabolism
smic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SmB9_06130
Enzymes [BR:smic01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SmB9_06130
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     SmB9_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: BBE32955
Position
complement(626716..627921)
Genome map
AA seq 401 aa AA seqDB search
MNALTPITASRRADFPGVADWAYLDSAATAQKPQAVIDAIAAAYGPEYATVHRGVYARSA
TMTERFEAARSTAARFINAASPNEIVFVRGATEAINLVAQTWGMTLKAGDRILLSRLEHH
SNIVPWQLLRDRTGIEIDVAPLTADHRIDEVALEAMLTPAHKLVAVAHVSNVLGSVADIA
RIARAAHAVGAKLLVDGCQAVPRMGVDVQALGADFYAFSGHKLYGPTGIGVLWARGDILS
AMPPWQGGGSMIETVTFEKTTYAPSPTRFEAGTPHIVGAVGLAAAMDYVSAIGLDVIDTH
ERHLAGLARTELRKVNSLRLFGPEDSSGIVSFAMEGVHPHDIGTILDEEGVAIRAGHHCA
QPLMDLLGVPATARASFGVYSDESDVDRLLRGIARVKRIFG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgctgacgccgatcaccgcttcgcgccgcgccgatttcccgggagtggccgac
tgggcctatctcgattccgccgccaccgcgcagaaaccgcaggccgtgatcgacgctatc
gctgccgcctacggccccgaatacgccaccgtgcatcgtggcgtttacgcgcgctcggcg
acgatgactgagcgcttcgaagcggcgcgcagtaccgccgcgcgtttcatcaacgccgcc
agcccgaacgagatcgttttcgtgcgcggcgcgaccgaggcgatcaacctcgtcgcgcag
acgtgggggatgaccctcaaggccggcgaccgcatcctgctctcgcggctggagcatcat
tcgaacatcgtgccgtggcagctcctccgcgaccgcaccggcatcgagatcgatgtcgcc
ccgctcaccgccgaccaccgcatcgatgaagtcgcgctggaagcgatgctcactcccgcg
cacaagctcgtcgccgtcgcccacgtctcgaacgtgctcggctcggtcgccgatatcgcc
cgcatcgcgcgcgccgcgcacgctgtcggtgcgaagctgctcgtcgatggctgtcaggcg
gtgccgcgcatgggcgtggatgtgcaggcgctcggcgccgatttctacgccttctcgggc
cacaagctctacggccccacgggcatcggcgtgctgtgggcacgcggcgatatcctctcg
gcgatgccgccgtggcagggcggcggctcgatgatcgagacggtgacgttcgaaaagacc
acctacgcaccctcgcccacccgtttcgaggcaggcacgccccacatcgtcggcgccgtc
ggcctcgccgccgccatggattatgtgtcggcgatcggtctggatgtcatcgacacgcac
gaacggcacctcgcgggccttgcgcgcacagagctgcgcaaggtcaattcgctgcgcctg
ttcgggccggaggattccagcgggatcgtcagtttcgcgatggaaggggttcatccccac
gacatcggcaccatattggatgaagaaggcgtcgccatccgcgccgggcatcactgcgcc
cagccgctgatggacctgctcggcgtgccggccacggcgcgcgccagcttcggcgtctac
agcgatgaaagcgatgtcgatcggctgcttcgcggcatcgcgcgggtgaagaggattttt
ggatga

DBGET integrated database retrieval system