KEGG   Sphingosinicella microcystinivorans: SmB9_11960Help
Entry
SmB9_11960        CDS       T05811                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
smic  Sphingosinicella microcystinivorans
Brite
KEGG Orthology (KO) [BR:smic00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SmB9_11960
Enzymes [BR:smic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SmB9_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BBE33538
Position
complement(1249719..1250543)
Genome map
AA seq 274 aa AA seqDB search
MTTRIAIAQMTSGTDSAVNAAVLSGYVEAAAAGGATMLFTPEMSGMLDRNTARLFANARG
EDEDVALAAVREAAQKTGIWVALGSLALRDARHADRLVNRSLVIDDKGEIHARYDKMHLF
DVEAAPGEYYRESASFVAGAGVALAETPVGTLGLAICYDVRFPRLFDALSGAGAEVIALP
AAFTRPTGRAHWHTLLRARAIETASFVVAAGQTGEHEDGRSTYGHSLVIDPWGDILLDAG
EEPGLHFAEIDLERIADVRRRIPVLQHRRDIAAP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacgcatcgccatcgcccagatgacgtccggcacggactccgccgtcaacgcc
gccgtgctctccggctatgttgaggccgcagcagcaggcggcgcgacaatgctgttcacg
cccgagatgtccggcatgctggaccggaacaccgcgcgcctcttcgccaatgcccgcggc
gaggacgaggatgtggcgctcgccgccgtgcgcgaggccgcccagaaaacgggcatttgg
gtggcgctcggctcgctcgcgctacgcgatgcgcgccatgcggaccgtttggtcaaccgc
agcctcgtgatcgacgacaagggcgagatccatgcgcgatacgacaagatgcacctgttc
gatgtcgaggccgctccgggcgaatattaccgcgaatccgctagctttgtggcgggcgca
ggcgtcgcgctcgccgaaacgcccgtcggcacgctcggtctggcgatctgctacgacgta
cgcttcccgcgcctgttcgatgcgctgagcggcgcaggcgccgaggtgatcgcgctcccg
gccgcgttcacgcgccccacgggacgcgcgcattggcacacgctgctgcgcgcccgcgcc
attgaaacggcctcgttcgtggtcgccgccgggcaaaccggtgagcacgaggacggacgc
tccacctacggccactcgctggtgatcgatccctggggcgacatcctgctcgatgcgggc
gaagagccggggcttcacttcgccgaaatcgatcttgaacgtattgccgacgtgcgccgc
cgcatcccggtgctgcagcaccgtagggacatcgctgcgccgtga

DBGET integrated database retrieval system