KEGG   Sphingosinicella microcystinivorans: SmB9_13030Help
Entry
SmB9_13030        CDS       T05811                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic03010  Ribosome
Brite
KEGG Orthology (KO) [BR:smic00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SmB9_13030 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:smic03011]
    SmB9_13030 (rplV)
Ribosome [BR:smic03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SmB9_13030 (rplV)
  Bacteria
    SmB9_13030 (rplV)
  Archaea
    SmB9_13030 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BBE33645
Position
1346811..1347197
Genome map
AA seq 128 aa AA seqDB search
MSKAANPRRVGEREALAVATTVRGSAYKLNLVAGLIRGKKAGEALNILTFSTKAMAVDVR
KVLASAIANAENNHNLDVDALVVKEASVGKSITMKRWTPRARGRSAKIMKPISRIRIVVR
EADEEAGA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggctgcaaacccccgtcgtgtcggcgagcgtgaagcgcttgcagtggcgacg
accgtgcgcggttcggcatacaagctgaacctcgttgccggtcttattcgcggcaagaag
gccggcgaagcgctcaacatcctcaccttctccacgaaggcgatggccgttgacgttcgc
aaggttctcgcctcggcgatcgcgaatgcggaaaacaaccacaacctcgacgtcgatgcg
ctcgtggtgaaggaagccagcgtcggcaagtcgatcacgatgaagcgctggacgccgcgt
gcgcgtggtcgttcggcgaagatcatgaagccgatcagccgcattcgcatcgtggtgcgt
gaagcggacgaagaggcaggagcgtaa

DBGET integrated database retrieval system