KEGG   Sphingosinicella microcystinivorans: SmB9_17430Help
Entry
SmB9_17430        CDS       T05811                                 

Gene name
hadL_1
Definition
(GenBank) dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00361  Chlorocyclohexane and chlorobenzene degradation
smic00625  Chloroalkane and chloroalkene degradation
smic01100  Metabolic pathways
smic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SmB9_17430 (hadL_1)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SmB9_17430 (hadL_1)
Enzymes [BR:smic01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SmB9_17430 (hadL_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 HAD Hydrolase
Motif
Other DBs
NCBI-ProteinID: BBE34085
Position
1812214..1812891
Genome map
AA seq 225 aa AA seqDB search
MSYIPSFQPEYISFDCYGTLIRFRMAEMARAFFADRLPAEAMDEMCRRFATYRFDEVLGA
WQPYREVLRNSVRRTAKAMGVEYREADGDALYEAVPTWGPHADVPGGLSKIADKIPLVIL
SNAMNEQIDRNVALLGAPFHRVYTAESAQAYKPHMKAFEYMFDQLGCGPEVMMHVSSSFR
YDQNTASDLGFGCRVFVARGHEPSNANYRDVEIPHIGCLPAVVGL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatattcccagcttccagcccgagtacatcagctttgactgttacggcacgctg
atacgatttcgcatggcggagatggcgcgggcgttctttgcggaccggctcccggccgaa
gcaatggacgagatgtgccgccgctttgccacctaccgcttcgacgaggtgctgggcgcc
tggcaaccctaccgcgaagtcctgcgcaattcggtacgccgcacggcgaaggcgatgggg
gtcgaatatcgcgaagccgacggcgatgcgctttacgaggccgtgccgacctgggggccg
catgccgatgtgcccggagggctttcgaaaatcgccgacaagattccactggtgatcctg
tccaacgccatgaacgagcaaatcgatcgcaacgtcgcactgctcggcgcaccgttccac
cgggtttataccgcggaaagcgcgcaggcctacaagccgcacatgaaggccttcgaatac
atgttcgatcagcttggctgcggtcctgaggtcatgatgcacgtctcctcaagcttccgc
tacgaccagaacaccgcaagcgacctcggcttcggctgccgggtcttcgtcgctcggggg
catgagccgtcgaacgcaaactaccgcgacgtcgaaattccccatatcggctgccttcca
gccgtggtggggctgtga

DBGET integrated database retrieval system