KEGG   Sphingosinicella microcystinivorans: SmB9_17560Help
Entry
SmB9_17560        CDS       T05811                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00010  Glycolysis / Gluconeogenesis
smic00053  Ascorbate and aldarate metabolism
smic00071  Fatty acid degradation
smic00280  Valine, leucine and isoleucine degradation
smic00310  Lysine degradation
smic00330  Arginine and proline metabolism
smic00340  Histidine metabolism
smic00380  Tryptophan metabolism
smic00410  beta-Alanine metabolism
smic00561  Glycerolipid metabolism
smic00620  Pyruvate metabolism
smic00625  Chloroalkane and chloroalkene degradation
smic00903  Limonene and pinene degradation
smic01100  Metabolic pathways
smic01110  Biosynthesis of secondary metabolites
smic01120  Microbial metabolism in diverse environments
smic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmB9_17560
   00053 Ascorbate and aldarate metabolism
    SmB9_17560
   00620 Pyruvate metabolism
    SmB9_17560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SmB9_17560
   00561 Glycerolipid metabolism
    SmB9_17560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SmB9_17560
   00310 Lysine degradation
    SmB9_17560
   00330 Arginine and proline metabolism
    SmB9_17560
   00340 Histidine metabolism
    SmB9_17560
   00380 Tryptophan metabolism
    SmB9_17560
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SmB9_17560
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SmB9_17560
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SmB9_17560
Enzymes [BR:smic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SmB9_17560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh KfrA_N
Motif
Other DBs
NCBI-ProteinID: BBE34098
Position
1827024..1828442
Genome map
AA seq 472 aa AA seqDB search
MAGHAYIGGEWVVVSGSERLPVINPSNGERVTEIVAGTSADLDRAVAAARSAFPTFSTSP
VAERLALLERIHALILERAEPLAQVLTLEMGAAITHARTAHIPFAASHVQAAIDVLRDYD
FLTMRGTTAIVREAIGVAGLITPWNWPLYQITAKVAPALAAGCTVVLKPSELSPLNALMF
AQIVHDAGAPPGVFNLINGTGSEVGAAMAAHPDIDMISITGSNRAGVLVAQGAAPTVKRV
TQELGGKSPNVLLPDADFERAVPLGVMAAFRNVGQSCSAPTRMIVPRSRLAEVEAIARRT
VEAIVVGEPGEEATTLGPIANRAQFQRVQTMIAVGLEEGAKLVCGGPGQPRGLNHGYYLH
PTVFSEVSSAMHIAQEEIFGPVLAILPYDDIDEAVSIANDTIFGLGGHVQGTDIDLARSV
ALRIRTGQVHINHPAWDAHAPFGGYKRSGNGREYGVFGFEEYLEIKAVLGFA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttggccggtcacgcctatatcggtggcgaatgggtggtggtttccggaagtgaacggctg
cccgtcatcaacccgtcgaacggggaacgcgtcacggaaatcgtggcgggaacaagcgcc
gacctcgatcgcgcagtcgccgcggctagatctgcatttccaacgttctcgacgtcccct
gtggccgaacggcttgccttgctcgagcggattcacgcgctgattctcgagcgcgccgaa
ccattggcccaggtccttacgctggaaatgggcgctgcgatcacgcacgcccgcacggcc
cacattcccttcgccgcgtcgcatgtccaggcagcgatcgacgtgcttcgagattacgac
ttcctgacgatgcgcggcacgaccgcaatcgttcgcgaggcgatcggcgtggcgggcctg
attacgccgtggaactggccactctaccagatcaccgccaaggttgcgcccgcactcgcc
gcaggttgcacggtggtgctcaagcccagtgagttgtcaccgctgaatgccctgatgttc
gcccagatcgtacatgatgcgggcgcacctcccggcgtattcaacctgatcaacggaacc
ggcagcgaagtcggcgcggcaatggcggcccatcccgacatcgacatgatatcgatcacc
gggtccaaccgcgctggtgttcttgtggcccagggcgccgcgcccacggtcaagcgggtg
acgcaggagcttggcggcaaatcccccaacgtgctgcttcccgatgccgatttcgaacgg
gctgtcccgcttggcgtgatggcggcgttccgcaacgtcggtcagtcgtgcagcgcgccg
acgcgcatgatcgtgccgcgttcacggctcgcagaggttgaagccattgcgcgcaggacg
gtggaagcgatcgtcgtcggcgagccgggggaggaagcgacgacgcttggtcccattgcc
aaccgggcacagttccagcgcgtgcaaaccatgattgcggtgggcttggaagagggggcg
aaactcgtctgcggcggcccggggcagccccgcgggctgaaccacggctactacctgcac
cccaccgttttctccgaagtgtccagcgccatgcacatcgcgcaggaagagatcttcgga
cccgttcttgccatactgccttacgacgacattgacgaggccgtgtcgattgccaacgat
accatatttggccttggcgggcatgtgcagggtacggacatcgacctcgcccgcagcgtg
gccctgcgtatccgcactggccaggttcacatcaatcaccctgcgtgggacgcccatgcg
ccgttcggcggctacaaacggtccggtaacggccgcgaatacggggttttcggctttgag
gaataccttgaaataaaggctgtccttggtttcgcatga

DBGET integrated database retrieval system