KEGG   Sphingosinicella microcystinivorans: SmB9_18110Help
Entry
SmB9_18110        CDS       T05811                                 

Gene name
trxB_1
Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SmB9_18110 (trxB_1)
Enzymes [BR:smic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SmB9_18110 (trxB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 FAD_oxidored FAD_binding_2 GIDA DAO HI0933_like NAD_binding_7 Thi4 NAD_binding_8 FAD_binding_3 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: BBE34153
Position
complement(1887106..1888074)
Genome map
AA seq 322 aa AA seqDB search
MRKDKTPATRHSKVLIIGSGPAGYTAAVYAARAALAPILIEGPQPGGQLMITTDVENWPG
DTSVLGPDLMARMGEQVRKTGVDVVSDLIVSVDLSRAPFLAIGDRGTHYTADTIVVATGA
SARWLGLDSETAYRGGGVSACATCDGFFYRGRVCAVVGGGNTAVEEALYLTNFAEKVYLI
HRRDTLRADRTNQARLAANPKVEMIWNAEVADVVGDGTVVTGISLRDTRDGKVTSLPVEG
LFVAIGHDPATALFTGQLQMDDEGYILVTPGSTATSVPGVFAAGDVQDKLFRQAVTSAGM
GCMAALEAERYLAGHTSHAIAA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggataagacgccggcaacccggcacagcaaggtcctgatcattgggtcgggt
ccggccggatataccgcagcggtctacgccgcccgtgccgcgctggccccgatcttgatc
gaggggccacagcccggtggccagttgatgatcaccacggatgtggagaactggccgggc
gacacaagtgtccttggtcccgaccttatggcgcgaatgggcgaacaggtgcgaaagacc
ggagtcgacgtggtcagcgacctgatcgtatcggtcgacctgtcccgcgcacccttcctc
gccatcggcgaccgcgggacgcattataccgccgatacgatcgtggtggcgaccggcgca
tcggcgcgctggctggggctggacagtgagaccgcctatcgaggcgggggtgtgtcggcc
tgcgcgacctgcgacggcttcttctatcgcggccgtgtctgcgccgtcgtgggcggcggt
aatacggcggtggaggaagcgctgtacctgaccaacttcgccgaaaaagtctatctgatc
caccggcgcgacacgctgcgcgccgaccgcaccaatcaggcgcgactggcggccaatccg
aaagtcgagatgatctggaacgccgaggtcgcagacgtcgtgggcgacggtacggttgtg
accggcatatcgctgcgcgacacgcgcgacggtaaggtgacgtccctgccggtcgaaggt
ctgtttgtcgcgatcggccacgatcccgccaccgccctgtttacggggcagctccagatg
gacgatgaaggctatatcctggtcacacccggctctacggcgacgagcgtccccggcgta
tttgccgcgggggatgttcaggacaaactgttccgacaagctgtcacgtcggccggtatg
ggctgtatggcggcgctggaagcggaacgctatctggccgggcataccagccacgcgatt
gccgcctaa

KEGG   Sphingosinicella microcystinivorans: SmB9_28400Help
Entry
SmB9_28400        CDS       T05811                                 

Gene name
trxB_2
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SmB9_28400 (trxB_2)
Enzymes [BR:smic01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SmB9_28400 (trxB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 FAD_oxidored NAD_binding_9 DAO NAD_binding_7 K_oxygenase Thi4
Motif
Other DBs
NCBI-ProteinID: BBE35182
Position
complement(3007861..3008826)
Genome map
AA seq 321 aa AA seqDB search
MGETKQVRVAVIGSGPAGYTAGVYAARAALNPVIIRGLQPGGQLTITTDVENWPGESMIL
GPDLMDKMAAQAKHVGAEIVDDLVSDVDFSQRPFRLTLDSGNVYLADTVVIATGAQARWL
GLESEGRFRGFGVSACATCDGFFYRGKTVAVVGGGNTAVEEALFLTNFAQKVYLIHRRDE
LRADKTNQARLLANPKVEAVWNVEVAEVTGASDPLGVTGLKLRGTNGAADRTLDVDGLFI
AIGHDPATSLFKGKLNMDGEGYILTAPDSTATSVPGVFAAGDVKDKVFRQAVTAAGMGCM
AALEAERFLAHHEAGLAEAAE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaacgaagcaggttcgcgttgcggtgatcggttcgggtccggctgggtatacg
gccggcgtctatgcggcgcgcgccgcgctcaatcccgtcatcatccgcggcctgcagccg
ggtggacagctcaccatcaccacggacgtcgaaaactggccgggcgaatcgatgatcttg
ggccccgatctgatggataaaatggcggcgcaggcgaagcacgtcggcgcggagatcgtc
gacgacctcgtctccgatgtcgatttctcgcagcggccgtttcggctgacgctcgattcg
gggaacgtctatctggccgatacggtcgtgatcgcgaccggagcgcaggcgcgctggctc
gggcttgagagcgaggggcgctttcgcggctttggcgtttccgcgtgcgcgacctgcgac
ggcttcttttatcgcggcaagaccgtcgcggtcgtcggcggcggcaatacggcagtggag
gaagcgctgttcctcaccaacttcgcgcaaaaggtctatctcattcaccgccgtgacgaa
cttcgtgcggacaagacgaaccaggcacgcctgctcgccaatcccaaggttgaagcggtg
tggaacgtggaggttgccgaggtgaccggcgccagcgatccgctgggcgttaccgggctc
aagctgcgcggtacgaacggcgcggcggatcgcacgctcgatgtcgacggcctgttcatc
gcgatcggccatgatccggcgacgtccctgttcaaaggcaagctgaacatggacggggag
ggctatatcctcaccgcgcccgacagcaccgcgacttccgtgcccggcgtgttcgcggcg
ggcgatgtgaaggacaaggtgttccgccaggctgtgacggccgccggcatgggttgcatg
gcggcgctcgaggctgagcgtttcctcgcgcaccacgaagccggactcgcggaagcggcc
gagtaa

DBGET integrated database retrieval system