KEGG   Sphingosinicella microcystinivorans: SmB9_19010Help
Entry
SmB9_19010        CDS       T05811                                 

Gene name
cysD
Definition
(GenBank) sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00230  Purine metabolism
smic00261  Monobactam biosynthesis
smic00450  Selenocompound metabolism
smic00920  Sulfur metabolism
smic01100  Metabolic pathways
smic01110  Biosynthesis of secondary metabolites
smic01120  Microbial metabolism in diverse environments
smic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SmB9_19010 (cysD)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SmB9_19010 (cysD)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SmB9_19010 (cysD)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SmB9_19010 (cysD)
Enzymes [BR:smic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SmB9_19010 (cysD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: BBE34243
Position
1994275..1995177
Genome map
AA seq 300 aa AA seqDB search
MKPLTHLDRLEAESLHIFREVVAECEKPVMLYSIGKDSAVMLHLAKKAFYPAPPPFPLLH
VDTTWKFRAMYDLREKSAADAGMDLLVWHNPEAKERGINPFDHGSALHTDMWKTEGLKQA
LDHYGFDAAFGGARRDEEASRAKERIMSFRTSTHRWDPKNQRPELWNLFNVRKNKGESIR
VFPISNWTELDIWQYIHRENIPIVPLYFSQERPTVRRGDLLLMVDDDRFPLAEGETPEMR
SIRFRTLGCYPLTGAVESKAATLPEIIQEMLLTTTSERQGRAIDHDQAASMEKKKQEGYF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttgacccatctcgatcgccttgaagccgaaagccttcacatcttccgcgag
gttgtcgcggagtgtgagaagccggtgatgctctattccatcggcaaggattcagccgtg
atgctgcatctggcaaagaaggcgttctatccggcgccgccgccgttcccgctgctgcat
gtcgacacgacgtggaagttccgcgccatgtacgacctgcgcgagaagtccgctgcggat
gcgggaatggatctccttgtctggcacaatccggaggcgaaggagcggggcatcaacccg
ttcgatcacggctcggcgctccacaccgacatgtggaaaaccgaaggcctgaagcaggcg
ctcgaccactacggcttcgatgcggccttcggcggcgcacggcgcgatgaagaggcgagc
cgcgccaaggagcggatcatgagcttccgcacatcgacgcaccgctgggacccgaagaac
cagcgtccggagctgtggaacctcttcaacgtccgcaagaacaagggcgaaagcatccgc
gtcttcccgatctcgaactggaccgagctcgacatctggcaatatatccaccgcgagaac
atccccatcgtgccgctgtacttctcgcaggagcgcccaacggtgcggcgcggcgacctg
ctgctgatggtggacgacgaccgcttcccgctcgccgagggtgaaacgccggaaatgcgc
tcgatccgattccgcacgctcggctgctatccgctgaccggcgcggttgagagcaaggcg
gcgacgctgccggagatcatccaggaaatgctgctcaccaccacctccgaacggcagggg
cgggcgatcgaccacgatcaggccgcctcgatggaaaagaagaagcaggaggggtatttc
tga

KEGG   Sphingosinicella microcystinivorans: SmB9_19020Help
Entry
SmB9_19020        CDS       T05811                                 

Definition
(GenBank) adenylyl-sulfate kinase
  KO
K00955  bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
smic  Sphingosinicella microcystinivorans
Pathway
smic00230  Purine metabolism
smic00261  Monobactam biosynthesis
smic00450  Selenocompound metabolism
smic00920  Sulfur metabolism
smic01100  Metabolic pathways
smic01110  Biosynthesis of secondary metabolites
smic01120  Microbial metabolism in diverse environments
smic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smic00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SmB9_19020
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SmB9_19020
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SmB9_19020
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SmB9_19020
Enzymes [BR:smic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     SmB9_19020
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SmB9_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS_kinase GTP_EFTU MMR_HSR1 GTP_EFTU_D2 AAA_33 RsgA_GTPase Zeta_toxin AAA_18 AAA_29 G-alpha AAA_16 Torsin ABC_tran AAA_17
Motif
Other DBs
NCBI-ProteinID: BBE34244
Position
1995177..1997081
Genome map
AA seq 634 aa AA seqDB search
MALEVYGSSDLIERDIEAYLEQHENKSLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQL
AKLAADSKTVGTQGGALDFALLVDGLAAEREQGITIDVAYRFFATDKRKFIVADTPGHEQ
YTRNMVTGASTADLAIILIDARKGVLTQTRRHTYLAHLLGIRNLVLAVNKMDLVGYDRAA
FDRIVLDYRAFATEIGVTRFKAIPISGLAGDNIGSRSDNTSWYDGPSLVEYLETVEVDGT
AHQEGPLRMPVQWVNRPDLDFRGFAGQIAAGSVKPGDAVRVVPSGKTSSVARIVTAGGDL
DEAVAGQSVTLTLADEIDCSRGDVIVSADSPLEVADQFEATVVWMADAKMLPGRPYWLKL
GTTTVSATITEPKYEVNVNTLERLAAKTLDLNAIGVVNIALGKPIPFAPYAESRELGGFI
LIDRMTNATVGAGLIHFALRRSQNIHWQAADITREAHAAQKAQQPKLLWFTGLSGAGKST
IANLVEKKLFALGKHTFLLDGDNVRHGLNKDLGFTEADRVENIRRVGEVAKLMTDAGLIV
LTAFISPFRAERQMVRAMLPEGDFIEVFVDTPLAEAEKRDVKGLYKKARAGQLRNFTGID
SPYEAPEAPEIRIDTTHMSPEAAADAIVERLLEA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgaagtttacggctcctcggacctcatcgaacgcgacatcgaagcgtatctt
gagcagcacgagaacaagtcgctgctgcgcttcatcacctgcggctcggtggatgacggc
aagtcgacgctgatcggccggctgctttacgacagcaagatgatcttcgaagaccagctc
gcgaagcttgcggcggactcgaagaccgtgggcacgcagggcggcgcgctcgatttcgcg
ctgctcgtggatggcctcgccgccgagcgcgagcagggcatcaccatcgacgtcgcctat
cgctttttcgcgaccgacaagcgcaagttcatcgtcgccgacacgcccggccacgagcag
tacacacgcaacatggtcacgggcgcgtccacggcggacctcgccatcatccttatcgat
gcgcgcaagggcgtgctgacgcagacgcgccgccacacctatctcgcgcacctgctcggc
atccggaacctggtgctcgcggtcaacaagatggacctcgtcggctacgaccgcgccgcc
ttcgatcgcatcgtgctcgattaccgcgccttcgcgaccgagatcggcgtcacgcgcttc
aaggcgatcccgatttccggcctcgctggagacaatatcggcagccgcagcgacaatacg
tcgtggtacgatggccccagccttgtcgagtatctggaaacggtcgaggtggacggcacc
gcgcatcaggagggcccgttgcggatgcccgtgcagtgggtgaaccggccggacctcgat
ttccgcggttttgcgggacagatcgctgccggaagcgtgaagccgggcgacgcggtgcgc
gtcgtgccctcgggcaagacctcaagcgttgcgcgtatcgtcacggcgggcggcgatctt
gacgaggcggtggcgggccagtcggtcacgctcacgcttgccgacgagatcgattgctca
cgcggggacgtgatcgtgtcggcggactcgccgctcgaagtcgccgaccagttcgaagcg
accgtcgtctggatggcggacgcgaagatgctgcctggtcgaccctattggctcaagctc
ggcaccacgaccgtctcggcgacgatcaccgagccgaagtacgaggtgaacgtcaacacg
ctcgagcgccttgccgcgaagacgcttgatctgaatgcgatcggcgtcgtcaatatcgcg
ctcggcaagccgattccgttcgcgccttatgccgaaagccgcgaactcggcggcttcatc
cttatcgaccggatgacgaacgccaccgtcggcgccggcctcatccatttcgcactgcgc
cgctcgcagaacatccactggcaggcggcggatattacgcgcgaggcgcacgccgcgcag
aaggcgcagcagcccaagctgctctggttcaccgggctttcgggcgcgggcaagtccacc
atcgccaacctcgtcgagaaaaagctgttcgcgcttggcaagcacaccttccttctcgac
ggagacaacgtccgccacggtctcaacaaggacctcggcttcacggaggccgaccgcgtg
gagaacatccgccgcgtaggcgaagtggcgaagctgatgacggatgcgggtctgatcgtg
ctcaccgccttcatttcgccgttccgcgcagagcggcagatggttcgcgcgatgctgccg
gagggcgacttcatcgaggttttcgtcgataccccgctcgccgaggccgaaaagcgcgac
gtgaagggcctctacaagaaggcccgcgccggtcagctgcgcaacttcaccggcatcgac
agtccctacgaggccccagaagcccccgaaatccgcatcgacaccacgcacatgtcgccg
gaggcggcggcggatgccatcgtggaacggctgctggaagcctga

DBGET integrated database retrieval system