KEGG   Breviolum minutum: v1.2.000687.t1Help
Entry
v1.2.000687.t1    CDS       T04349                                 

Gene name
symbB.v1.2.000687.t1
Definition
(OIST) -
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    v1.2.000687.t1 (symbB.v1.2.000687.t1)
Enzymes [BR:smin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     v1.2.000687.t1 (symbB.v1.2.000687.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase DUF3875
Motif
AA seq 287 aa AA seqDB search
MADVRRASFKVGLCQMTARNDKELNFQRCRDLVVKAAKEGCSLVSLPECFSFIGAQKGEA
QKAAESLEGPTMARYRQLARDENVWLSLGGFQEKVEGEPDDKILNTHVIVNSSGDMVAVY
RKIHLFDAPFTGLIESQQTIAGSEVVSCESPVGKLGVTVCYDVRFPELYQKLRFQHGVDV
LLIPSAFSMPTGEAHWELLMRTRAVESQCYVLAAAQAGQHNEDGNLRRSWGHAMAVDPWG
KVLCEFDGTSEGVKVVELCPETIQEVRQKMPLADQRRYDIYGPNIAG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttctttcgacccctttcagcggccatcgggcgacgaaatcgcccgatggcggacgtgcgc
cgggcgtccttcaaggtcggtctatgtcaaatgaccgcgcgcaatgacaaggagttgaac
ttccaacgctgtcgcgacttggtcgtgaaagcagcgaaagaggggtgctccttggtgtcc
ttgccggaatgtttcagttttattggtgcacagaagggagaagcccaaaaagcggcggaa
agtttggaaggacctaccatggcaagatatcgtcagttagctcgagatgaaaatgtatgg
ctttcacttggaggatttcaagaaaaagtcgaaggagagcctgatgacaagattctgaac
acccatgtgatcgtcaacagttctggggacatggtggcagtctacagaaagattcattta
tttgatgcaccattcactggtttgatcgagtcgcaacaaacgattgcaggaagcgaggtg
gtctcgtgtgagagtcctgtgggaaagttgggcgtcacggtgtgctatgatgtgcgcttt
cccgaactctatcagaagttgcgcttccaacatggcgtggacgtcttgctgattccatcg
gccttttcgatgccgacgggtgaagcgcactgggagcttttgatgcgaacacgtgctgtt
gagtctcaatgctatgtcttggcagctgcacaggcaggtcaacacaacgaggatggtaac
ttacgacgatcttggggccatgccatggcagtagatccatggggaaaggtgctatgtgag
tttgatggcacctcagagggagtcaaagtagtggaactatgtcccgagaccattcaggag
gtgcggcaaaaaatgcctttggcagaccagcggcgctacgacatctatggccccaacatt
gctggctgaacgtcgaaaaactcgtcgaaaatcgtcagtgggaggaagtggatgaggttt
agtgaatgtttagtgggtcgagttgaagattttggatttgtaaatgtggaaaaaatcacc
tccagtatc

DBGET integrated database retrieval system