KEGG   Breviolum minutum: v1.2.001670.t3Help
Entry
v1.2.001670.t3    CDS       T04349                                 

Gene name
symbB.v1.2.001670.t3
Definition
(OIST) -
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
smin  Breviolum minutum
Pathway
smin00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:smin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    v1.2.001670.t3 (symbB.v1.2.001670.t3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smin01007]
    v1.2.001670.t3 (symbB.v1.2.001670.t3)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smin03016]
    v1.2.001670.t3 (symbB.v1.2.001670.t3)
Enzymes [BR:smin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     v1.2.001670.t3 (symbB.v1.2.001670.t3)
Amino acid related enzymes [BR:smin01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   v1.2.001670.t3 (symbB.v1.2.001670.t3)
Transfer RNA biogenesis [BR:smin03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    v1.2.001670.t3 (symbB.v1.2.001670.t3)
 Prokaryotic type
    v1.2.001670.t3 (symbB.v1.2.001670.t3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1
Motif
AA seq 203 aa AA seqDB search
MEEGEGALAADDEKRSPNDFALWKKSKPGEPAWPSKWGPGRPGWHIECSVMATDKNGACL
DIHAGGEDLKFPHHDNEMAQSEAYLQRSQWVNYFWHAGHLHIEGLKMSKSLKNFITIRQA
LTMHSARQLRLMFLMQAWDKGMNYSDQACKRLRSGHSSRSVESLVAVAAVAGVSPSHGFV
IGLSQGRVAAIGGSLKAVSRENS
NT seq 911 nt NT seq  +upstreamnt  +downstreamnt
agggagcgtgtattttgacattgacgcatttcagaaattgggctaccattacaggaagct
cgtgcctgacctccatgcgacagccaaggagatggaggaaggtgaaggtgctctggcggc
agatgatgagaagagaagtcccaacgacttcgcactctggaagaaatcgaagccaggtga
gccagcttggcccagtaagtggggaccaggcagaccaggatggcacatcgagtgctctgt
catggcaaccgacaagaatggtgcatgcctggacattcatgcaggaggtgaagatctcaa
gttcccgcatcatgacaatgagatggcccaatcagaagcttatttgcaacgctcccagtg
ggtgaactacttttggcatgctgggcatttgcacattgaaggcctgaagatgtccaaatc
cttgaaaaacttcatcacgatccggcaggctctgacaatgcacagcgccagacaactgag
attgatgttcctcatgcaggcctgggataaaggcatgaactactcggaccaggcctgcaa
gagattgagatcagggcattcttcgagaagtgtcgaatccctggtcgcagtggcagcagt
ggcaggtgtttcaccatcccatggcttcgtgattggtttgagccagggcagagtggctgc
aattggtggcagcctcaaggcggtgagcagagaaaattcatgaaatatgtggcctttttg
aacaaggttgggatccctacaatgctgtgtgaaccacagccctctggttccccacaagaa
cctgtcaggcctttcctttatgtgcaaatgcacatcaacttgggtgaactgccggattcc
tactacctgacagagagagctgcaaaggagaagaagctgattcctgaaaagattaaatgc
gaattcattga

DBGET integrated database retrieval system