KEGG   Breviolum minutum: v1.2.004288.t1Help
Entry
v1.2.004288.t1    CDS       T04349                                 

Gene name
symbB.v1.2.004288.t1
Definition
(OIST) -
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
smin  Breviolum minutum
Pathway
smin03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:smin00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    v1.2.004288.t1 (symbB.v1.2.004288.t1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:smin03041]
    v1.2.004288.t1 (symbB.v1.2.004288.t1)
Enzymes [BR:smin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     v1.2.004288.t1 (symbB.v1.2.004288.t1)
Spliceosome [BR:smin03041]
 Complex C
  Other components
   Step II factors
    v1.2.004288.t1 (symbB.v1.2.004288.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_22 AAA_30 ATPase ABC_tran AAA_19 T2SSE AAA_7 PhoH NACHT AAA_16 Roc Sigma54_activ_2 SRP54
Motif
AA seq 665 aa AA seqDB search
MDTTERGSKRPRPASQTPELPILAFREEIVKAVRQHRVVVLVGETGSGKTTQVPRFLYEE
HVSNQPGSISVTQPRRIAAISVANRVASELGCEVGGLVGFHVRFSNKTSRETKIKYMTDG
MLVRESATGGARSGIRGSSIVILDEAHERSIHTDVLLGLVKKALEQDEPPGLRVVVMSAT
IHAAPFVNFFGGKEVKLIQVPGRQHAVQVYYTPSPEPDILEAALVAVLQLHVSRPPGDVL
VFLPGQDDIDSLQRLLEEKQDMLAKERQDNPAKHVVDQQGSFSFGMKTWPTFEQVQNLLE
LVFQKTPPGCRKIVLATNIAETSITISGIRYVIDTGLMKLKMNHPQTGVQMLRTVPTSQA
SALQRAGRAGREAPGEVFRLYVESEFHKLLAQTPAEILRVDMASVYMDLKALGISKIVNF
PLVDRPPREALEKAAHFLCRIGALDTKDELTDLGRKLAMMPLHPLYAYCLNMSFEFECTA
EILSIISLLSADAPIFATSKQRAQTKAFEHEDGDHLSLLSAFSQWKKHQHPKVFASQNGL
NHAALEKAVTIRKQLKDVVHEAWGEAQIASCGGPKNWATVRRCLLKGLFTQTARRDEVNQ
NSYRTFLSRQEAKLHPTSVLHRRQPPPPCIIYNELVITAKSYLRIVTEVDPAWLPELCPR
FFCTS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
ttctcgcttggacttcctgaagagcacaatgttactcatgggatctcatttgatgagatg
gacaccacagaacgtggatccaagcggcctcgtcctgcttcccagacacctgaactgcca
attcttgcgttccgcgaggagattgtgaaagcagtccgacaacatcgagtcgttgtcctc
gtcggcgaaaccggcagcgggaagacaacacaggtgccccgctttctctacgaggagcat
gtgtcaaatcaaccgggaagcatctcagtgactcaaccccgccgcattgctgcaatctct
gtcgcaaaccgggtggcttcagaactcggttgtgaagtcggaggtttggtaggttttcat
gtccgcttctccaacaagacatcacgggagaccaagatcaagtacatgactgatggtatg
ctggtcagggagtcagcaactggaggtgctcgttctggaattcgtggttcttccatcgtc
attttggacgaagcacacgagcgcagcatccacaccgatgtgctgctgggacttgtgaag
aaggcgttggagcaagatgagccgcccgggcttagagtggttgttatgtctgcaaccata
catgctgcaccctttgtgaatttctttggcggcaaggaggtgaaactcatccaagttcct
ggacggcagcatgccgtgcaagtttactacactccatcaccggagccagacattctggag
gcagcactggttgctgtcctacagctccatgtttctcgaccccccggagatgtacttgtt
ttcttgccgggtcaagatgatattgacagtttgcagaggctattggaggagaagcaggac
atgttggccaaagagaggcaagataaccctgccaaacatgtcgttgaccaacaaggcagc
ttctcctttggtatgaagacgtggccaaccttcgagcaagtgcaaaacctcttggagctt
gtgtttcagaagactcctccagggtgtcggaaaattgttctggcgacgaacattgcagag
acttcgatcaccatttcaggaatcagatatgtcatcgacacaggattgatgaagctgaag
atgaaccaccctcagacaggagttcaaatgctgaggacagtccccacatcacaagcttct
gcattgcagcgagctggtcgagcaggccgcgaagctccaggagaagtgtttcgtctctat
gtggagtcagagttccacaagctgcttgcacaaacgccagcagagattctccgtgttgac
atggcatcagtctacatggacttgaaggccttgggcatctcgaagatagtcaactttcct
ttggtggatcggccaccaagagaggcacttgagaaagcggcgcactttttatgtcgcatt
ggtgcattggacaccaaggatgaattgactgacttgggcagaaagttggcaatgatgccg
ttgcatccactgtacgcctattgcttgaatatgtccttcgaattcgagtgtactgcagag
atcctcagcatcatttctttgctgtcagcagatgccccgatctttgcgacatcaaagcag
cgtgctcagacaaaggcatttgagcatgaggatggcgatcatctctcgctcttgtctgca
ttcagccaatggaaaaagcatcagcacccgaaggtgtttgcgtcgcaaaatggtctcaat
catgctgcattggaaaaagcagttacgatccgcaaacaactgaaggatgtcgtgcacgaa
gcttggggagaagcgcagattgcaagttgtggggggccaaagaattgggcaacagtgcgg
aggtgccttctgaagggcctctttacgcagacagcacgccgagacgaagtgaaccagaat
tcgtacagaactttcctctcaagacaggaagcgaagttgcatcctacaagtgtccttcat
cggcgccagccaccaccgccctgcatcatctacaatgagttggtcataactgccaaaagc
tatttgcgaattgtcaccgaggttgacccagcttggcttccagagctgtgtcctcgtttt
ttttgcaccagctaataatctcaactacagattcaaaaatattttcaataagaataataa
gattaccaataataagacaaaaacaaaaat

DBGET integrated database retrieval system