KEGG   Breviolum minutum: v1.2.005292.t1Help
Entry
v1.2.005292.t1    CDS       T04349                                 

Gene name
symbB.v1.2.005292.t1
Definition
(OIST) -
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smin02000]
    v1.2.005292.t1 (symbB.v1.2.005292.t1)
   04147 Exosome [BR:smin04147]
    v1.2.005292.t1 (symbB.v1.2.005292.t1)
   04090 CD molecules [BR:smin04090]
    v1.2.005292.t1 (symbB.v1.2.005292.t1)
Transporters [BR:smin02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   v1.2.005292.t1 (symbB.v1.2.005292.t1)
Exosome [BR:smin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   v1.2.005292.t1 (symbB.v1.2.005292.t1)
CD molecules [BR:smin04090]
 Proteins
  v1.2.005292.t1 (symbB.v1.2.005292.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp
Motif
AA seq 929 aa AA seqDB search
MTEAAAVIRDQSGYIHTTPEKDLGPLDFTGRIGGGLVRDLKRRAPFFCSDWTDAAKPENL
QKVISTILYLFIAALAPAITFGSRFQDGTNGQFGVLEMIMSTAISGMLFATFAGQPLSIL
GATGPFLAYTLVVYDLAISFELEFMPLYFWTCMWCALFTVVVAVFDLCALMKHVTMFSED
IFAGLISLIFIIDGVRPIIENFALGEMALVNCFFEALLFILTFSTATYLSHFRRTPWMLR
PIRNLLANFSVTIALVFASALAAIYASDVQLRMLEVSAELTPTLMINGESRPWIVDPFGY
SSDFPASWWDLKGVVAYPGNMPLPDNVEEEIKKLVAASKDGKVVAGMTQLLSLCQTHGLM
QEMTIHPNSVCCHVDNRDGIGLNVMDVHQLIADISSIGFSHEMTNCICVEIASGDRAFMD
FNNRIADMSHGLLPRFGDAYRVKYASLAGSHTNAALRCLLDGTKHPIKDSKLANADGRFQ
FITKFAGGDAGVLSSQTEQRLRTSNMMSKELGNEFWMAVSKDSKTMDGQLVLLRHAAIAA
AFCNDKWINAADVRKMLSKENRPAATKVEQMLLQMRNIIDKKLSAEQSVQVRDLLDSFQD
GLVMSSVQKKPKGIEDFIVVPESHAAIFVAQVKDRVGVELTTAYDGYYVEPSPIQIRMHN
SSLQVTPSQMMCEMGFQVGCWVERKKDKVQASVVALSDDYVKMQCDDGQMYEITSKAFLE
GQFKLMKQPKDPVSIENYEEHLAMKSKDVDMAITKGRVLEALVALEKKHINVHKHLRLHF
KPMREIVALSGFGKGKLILVPGTCRVERADPSKGSGIALAQGMCLLASMVAPKGDDFSKA
WVSPFFMVKLTHEEDEANMELHVAPGSPFKIPILRNNKEVAAGDVLIRFEPKKEAEPLHP
LTPCVADDSAGADAKVKASPLKRRRVKSA
NT seq 3062 nt NT seq  +upstreamnt  +downstreamnt
atcctgccatttcactctccgcagcattttcttgctcccaacgggacctcgactctgctc
ggacttccgaacaccaggttctttagatgactgaggccgccgcagtgattcgtgaccagt
ccggttacatccacaccacaccggagaaggatttgggccctttggacttcacaggccgca
ttggaggtggtttggtgagggatttgaaacgtcgtgcgcccttcttctgcagtgattgga
cggatgccgcaaagcctgagaacctgcagaaggtcatttccacaatcctctacctcttca
tcgccgcattggctcctgccattacgtttggaagtcgctttcaggatggtaccaacggac
agttcggagttctggagatgattatgtccacggccattagtggaatgttatttgccacct
tcgctggacagcctttgtccattcttggtgccactggacctttcttggcttacaccttgg
tggtctatgacttggctatttcctttgagttggagttcatgcccttgtacttctggacat
gcatgtggtgtgccttgttcactgtcgtcgtggcggtctttgacctgtgcgcattgatga
agcacgtcaccatgttcagtgaagacattttcgccggcctcatctctttgatcttcatca
tcgatggtgtcaggcccatcatcgaaaacttcgcgttgggtgaaatggcattggtgaatt
gtttctttgaagccttgctcttcattttgaccttcagcaccgccacctatttgtcgcact
tccgtcgaactccttggatgttgcggcccatccgtaacttgttggccaacttctccgtga
ccatcgccttggtttttgcctccgccctggcggccatctatgccagcgatgtgcagttgc
gcatgttggaagtgagcgccgagttgactcctactttgatgattaacggtgaatctcgcc
cttggatcgttgacccctttggctactcttcggactttccagcttcttggtgggatttaa
agggagtggtagcatatcccgggaacatgccacttcccgacaatgtcgaagaagaaatca
agaagctggtggcagccagcaaagatggcaaagtagtagcgggtatgacccagttgctgt
cattgtgccagacccatggattgatgcaggagatgaccatccatcccaattccgtgtgtt
gccacgtggacaacagagatggcattgggttgaacgtcatggacgtccatcagctgatcg
ctgacatcagctcgattggattctcccatgagatgacgaactgcatctgcgtggagattg
cgagtggtgatcgtgcattcatggacttcaacaacaggattgctgacatgtcccatgggc
tactgccaaggttcggtgatgcgtatcgagtcaagtatgccagccttgcaggatcgcaca
caaatgctgccttgagatgtttgttggatggtacaaagcatcctatcaaggatagcaagc
ttgcgaatgctgatggcaggttccagttcatcacgaagtttgctggtggagatgcaggtg
tcctttccagccaaactgagcaaaggctccgcacttcgaacatgatgtccaaagaattgg
gaaatgagttctggatggcagtgtctaaggactccaagaccatggatggtcaattggtgt
tgctacgacacgctgcaattgcagcagcgttttgcaatgacaaatggatcaatgcagctg
atgttcgcaaaatgctctccaaagagaacaggccagctgcaaccaaggtggaacaaatgc
tcctgcaaatgaggaacatcattgacaagaagctgagtgcagagcagtcagtgcaggtaa
gggacttgctcgacagttttcaggatggcttggtgatgagttccgtgcagaagaaaccca
agggcattgaggacttcattgttgtaccggagtctcatgctgcaatctttgtggcgcaag
tgaaggacagggttggtgtggagctcacaacagcttacgatggatactatgttgagccaa
gcccgattcagatcaggatgcataattccagcttgcaggtgactccatcgcaaatgatgt
gtgagatgggttttcaggttggctgctgggtggaaaggaagaaagacaaggttcaagcga
gtgtggttgcgctgagtgatgactacgtcaaaatgcaatgtgatgatggtcaaatgtatg
aaatcacttccaaggcttttctagaaggacaattcaagctgatgaagcaacccaaagatc
cagtgtcgattgagaactatgaagaacatctagccatgaagtcaaaggatgttgacatgg
caatcaccaagggtcgtgtgcttgaagcgttggttgcacttgaaaagaaacacatcaatg
tccacaagcatttgcggctacatttcaagccgatgagggagatcgtggcattgagtgggt
ttgggaaaggaaagttgattttggtccctggcacctgcagggtcgagcgcgcagacccga
gcaagggctcagggattgcattggctcagggcatgtgcttactggcaagcatggtggcac
ccaaaggagacgacttctccaaggcatgggtgtcaccatttttcatggtcaaattgaccc
atgaggaggatgaggcaaacatggagttgcatgttgcaccaggcagtcccttcaagattc
ccatcctgagaaacaacaaggaggtggctgcaggtgatgttttgatccgctttgagccca
agaaggaagctgagcctttgcaccccttgaccccatgtgttgctgacgattcagcaggtg
ctgatgcaaaggtgaaggcatcaccgctcaagcgacgtcgtgtgaagtccgcataatgaa
tccacattgctgtccattccacaaaatgtatgtacttcaaaaacatactctcattactca
ttgatgtttcaactttgtttttctagtacaactgcagatcatttgacattccatgttacc
tggattggaagcaccaaaagaatatgtggatggacgagtctcaatatagcagaaagattt
tg

DBGET integrated database retrieval system