KEGG   Breviolum minutum: v1.2.007076.t1Help
Entry
v1.2.007076.t1    CDS       T04349                                 

Gene name
symbB.v1.2.007076.t1
Definition
(OIST) -
  KO
K03254  translation initiation factor 3 subunit A
Organism
smin  Breviolum minutum
Pathway
smin03013  RNA transport
Brite
KEGG Orthology (KO) [BR:smin00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    v1.2.007076.t1 (symbB.v1.2.007076.t1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:smin03012]
    v1.2.007076.t1 (symbB.v1.2.007076.t1)
Translation factors [BR:smin03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    v1.2.007076.t1 (symbB.v1.2.007076.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
AA seq 322 aa AA seqDB search
MTSFVKPENALKRAEELLEVGKQNEALETLHHAILHKRWKNQWSPTLEKIIERHLQLCVE
LQKMRFAREGLHQYRATCQAANIQSLEQVVRVFRKAAEEKVNQAKKDQDVRLGKVADLEE
LDAPETILLAAIQAGDTRQQSQDKDVHTHFRFLWETYKVILDVLKSNNRLEEVYHETSRQ
AFEFCRANSRPQEFKRLCDILRKNFQDLSKRTGPGGQNPVQPNNVETITKTLETRCRQMQ
VATELDLWREAYNTSSEICDLMAALGKVNQRPKPHLRSMYYEHLGQIFWKSENYLFHAFA
SLKNVLFVKGAKQNMPKSEPAT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
agtcggtggctcaattctgaactcacgcccgaaacgccacaccgaagcacggagccgttg
ccacacgggttcaaacacagctcgaggtattgctcattggggccaattgtaagacccaca
attttgctctcggaggttggacatgaccagcttcgtgaagcccgaaaacgccttgaaacg
tgccgaagaattgctggaggtcggcaaacagaatgaagccttggagactctccatcatgc
gattttgcacaaaagatggaagaaccaatggtcccccaccttggagaagatcattgagcg
tcatcttcaactctgcgtagagcttcagaagatgcgctttgcacgagaaggtcttcatca
ataccgtgctacatgtcaagctgccaatatccagtctttggaacaggtggttcgggtctt
ccgcaaagcagctgaggagaaggtgaaccaagcaaagaaagaccaggatgtgaggcttgg
aaaagttgcagacttggaagagctggatgcgcctgagaccatcctcttagcagcaattca
agctggagacacgcgccagcagagtcaggacaaagatgtgcacacgcacttccgcttcct
ttgggaaacctacaaggtgattctcgatgtgctcaaatccaacaaccgcttagaggaggt
ctaccacgagacttcccgtcaagcctttgagttttgccgagccaattctcgaccacaaga
gtttaagcgtctctgcgatatcttgcggaagaacttccaggacctgtccaagcgaactgg
tcctggaggtcaaaatccagtacagcccaacaacgtggagaccatcaccaagacgctgga
aacgcgctgccgacagatgcaagtagcgaccgagctggatttgtggcgtgaagcctacaa
tacgtcctcggagatttgtgatttgatggctgctttgggaaaggtgaatcaaaggcccaa
gccacatttgcggtccatgtactatgagcacctgggacagattttctggaagagtgagaa
ctatctcttccatgcttttgctagcctcaagaacgtgctctttgtcaagggagccaagca
gaacatgcctaagagtgagcctgcgacctaagtcttggagaaagtttgcaaagcaaatgt

DBGET integrated database retrieval system