KEGG   Breviolum minutum: v1.2.013953.t1Help
Entry
v1.2.013953.t1    CDS       T04349                                 

Gene name
symbB.v1.2.013953.t1
Definition
(OIST) -
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smin01001]
    v1.2.013953.t1 (symbB.v1.2.013953.t1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smin03036]
    v1.2.013953.t1 (symbB.v1.2.013953.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     v1.2.013953.t1 (symbB.v1.2.013953.t1)
Protein kinases [BR:smin01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   v1.2.013953.t1 (symbB.v1.2.013953.t1)
Chromosome and associated proteins [BR:smin03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     v1.2.013953.t1 (symbB.v1.2.013953.t1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    v1.2.013953.t1 (symbB.v1.2.013953.t1)
  Sister chromatid separation proteins
   Polo kinases
    v1.2.013953.t1 (symbB.v1.2.013953.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like
Motif
AA seq 2115 aa AA seqDB search
MRGRPFPIDISDMLDHILFLVQEEASRSRIIEVSCALSVLEEAGQVASEDKISDSSLWKQ
AINSRLCEIEQDGCTVSKAPPLSVATLVSLELFISDTDNRLYCRAIAWVILLCVWGCMRL
SDLEGLDPQRVILSSRGLRAILVRTKTTGPGKKVKETPIFLARRLSFTGGDWMKIGLDIW
DSFERKSRDYFVFAADRSLSNPIFKFASVETVAQYVRHVLSLLGVPSKQRNGGWKIKDLS
LFEEHGELFWFGHSMRHFLPSVAASVDIGKEQRDYVGRWHVNQHQSADYVHTSRQIVTRV
QESVNGCICSGGPGYDESELLTEYKQFLEARGVLEAGRVAGRHHIWRNTDDGIGYMLGVK
WPTLEVLENPDHVWDTSLVQTGHLRTALAADFTLRADNAAGRAEVAAVVAAWESSRQSYE
EEIKLRQEAKGLGLTRPLPHTDRSAMLRAVEQSKGEDMAEREQPSSEYIALLLEEIEQDE
VTAHTLDEVTSKKDSQTLQLQSSLDQSGRVRITRQKPKGKLPTTTEELRQKLRLEAHAWL
MVAAKMKNKVYLRGLEQKHFDRYTDYVLGDKCYQLLVPGASGEKQPLHPPWHILLDYDFE
LRKKAIRRAHKEARPLHATLKEATEDTELKELHFTSPVTFAAMERPKWEQDPPKGHKGKG
KGKKGKDQGKTSYLSGAKLELVTHTPDGKQICYRYNMKGKKCDGKCNRVHICRVRDIREH
LENLAEQFHYTLEMHEFDLLRGEDQDVLDSDFWTSLVDRVRKDPPFCIIATPPCSTYSRA
RHFYKESPGPRPIRSRQFPLGFPWLSTSNRQKAEEGTALACKMWEMFDIAREIGSHFLGE
FPEDLGATSTGVPASIWQMDAFFSLLANPGVMTMALFQCEFGASTPKPTRLITDLQNFDG
PYHEGIPTFTADWKYLGPLPKSCPHPNQHEPLIGLDDSGKWRTGPAAHYPGELCLFIAKA
IAKTFASWGRSLPHKREHSGVHFDGPKPQANAHSHPPQAGRSLPHKREHSGVHFDCPKPQ
ANAHSRPPQAVDASVGANFGFEPFEAPLDGEDCTAVETLDISYTEILSGCSGPPMTARYA
GRAENFVDGLGLCSFQSDYVGFWMDYSKFEIGLSERRTTWLVDFIKEMEHNDWLVNVKRF
QEFHGRLGFSAQVLPWLRPLLSPGYAWLAAVGKAATLRVPELLALSCIFIKEKFAKGLRK
IPCGLKELELGELFRTDAKCEPGRVVLGGWLIGSRADPWESPWFSLTLTPSETPWLFRGP
NQESSWASTSAELLGSLVALKVFDLGKNFKHLAASHIVKCGGGTDNKAASSVTSKRLSTK
LPLLIILMEYLGTCEEIGLRCHLDWRPRDTNTEADDLTNGRFEAFQDSRRILTLVAAAYG
LDLVMKPKVFGVSRSYGDLQNIDVIENRSVQCKSGLPSRYQKGRFLGKGGFAKCYEVQDL
ESKETFAAKIVAKSSVTKPRAYAKLRSEIAIHKELHHEKVVKFYEHFEDTEYVYIMLEVC
PNRTLNEFMRRRPPKRLVEPEAMFYMYDLIMALQYLHRRRVIHRDLKLGNLFLDKNMRLK
VGDFGLAAQLEYVGDKRHTICGTPNYIAPEILEGKHGHSFEVDIWSLGVIIYTMVFGRPP
FETSDVKTTYKRIRSNQYSFPDSVRVSNQVKDLIGHILQLDPGKRPSLENILNSSWLSSS
RFPPPMPESISLWVTSRGQVPPTTAPGLTPVLSARPGFSPYNLPSTPGRCQPGRPPVAQR
SNKENMVPNYDPVDFKDNCFNAGLVAMAAPNRTLSSARLGDSARILDSPSNAATLGAPGA
EEFGHFGTSSARQQSPRRAPDRGSRSLSPAVVRAATPRQEVFLDALSTVRKAPELRQRAG
LDSRPPSSYRACGQVQAQSPMPEIWVTKWVDYASKYGVGYILSDASIGVYFNDSTKIILV
PSGDFFDYITRRTPERAEERNTYSWENYPEELKKKVILLRNFKNYMVTDALERKDGASTG
SSSLKPPAAKATGCGQVPFVKKWTRNKHAIMFQLSNKTVQAGSLCFFGTDFAVLLILLAK
VIFFDKTEAVLSSKSHTVTYVDKRGQVQTYPLTNSFDVPSAELAKRLRYTKDILVNLLGS
RLPAGLPSVFATASA
NT seq 6760 nt NT seq  +upstreamnt  +downstreamnt
nnnnnnnnnnnnnnnnnnnagggcatggaagaaagtcagatcatggatgttattgatgag
aggccgtccatttccaattgatatttcagatatgcttgatcacatccttttcttggtgca
agaggaagcaagtcgttcgaggatcattgaggtcagctgcgcactttcagttttggaaga
ggcgggacaagttgcctcagaagacaaaatttcagacagttcattgtggaagcaggctat
caactctaggctgtgtgagattgagcaagatggatgcaccgtcagcaaggcaccaccttt
gagcgttgctacattggtatctttggagcttttcatttcagacactgacaatcgcttgta
ctgcagggcaattgcatgggtaatcttgctttgcgtctggggatgcatgaggctttctga
cttggaaggtttggatccacaacgagtcattctcagcagtcgcgggcttagagccattct
ggttcgaaccaaaacaacgggtccagggaaaaaggtgaaggagacaccaatatttttggc
acgtcgtctttctttcactggtggggactggatgaagattggactggacatttgggatag
cttcgaaaggaagagtcgtgattattttgtctttgctgcagacagatcactgagcaaccc
gattttcaaatttgcatcagtcgaaacggtggctcagtatgttagacatgtactgagcct
tctgggtgtgccgtcaaagcaaaggaatggcggctggaagatcaaggatctgagtttgtt
tgaagagcatggggagcttttctggtttggacattcgatgaggcatttccttccatcagt
ggcagcctcagtggacattggcaaggagcaaagagactatgtaggtcgatggcatgtcaa
tcaacatcagtctgctgactatgtgcacacttcaagacagatagtgactagagtgcagga
gtctgtcaacggttgtatttgcagtgggggcccgggttatgacgagtcggagcttctcac
agagtacaagcagttccttgaggcaagaggtgtcctggaagcagggcgtgtggctgggag
gcatcacatctggagaaacacggatgatgggattggctacatgctcggtgtcaagtggcc
cacactcgaggtgctggagaacccggatcatgtatgggacacctctttagttcagactgg
acacctaagaacagcacttgcagcagatttcacattgagggcagacaatgccgctggtag
ggccgaagttgcagcagttgtggcagcgtgggaatcgtcccgccaatcatatgaggaaga
gatcaagctgaggcaggaagcaaaaggtttgggtcttaccaggcccctacctcatacgga
tcgttctgcgatgttgagagccgtggaacagtcaaaaggtgaggacatggcggagcgaga
gcaaccgtcttcagagtacatcgctttgctgctggaggaaatcgagcaagacgaggtgac
ggcacatacattagatgaagtcacgagcaagaaagactctcagacacttcagcttcaatc
atccttggatcagtcaggacgtgtgaggatcactcgtcaaaagccgaagggcaaactgcc
gacgacgacggaagagttaaggcagaagcttcgtttggaagcacatgcttggctcatggt
tgcagctaagatgaagaacaaggtatatttgaggggcctcgagcagaagcattttgatcg
ctacacggactatgtgctgggagacaagtgctatcaactgctggtcccaggggcgagtgg
tgagaaacaacctcttcatccaccttggcacattttgcttgactatgattttgagctgag
gaagaaggccattcgtagggcccacaaagaagctagacctcttcatgccactttgaagga
ggctacagaggacaccgagttgaaggagttgcatttcacatcacctgtcacctttgctgc
tatggaaagacccaagtgggagcaagacccacccaagggccacaaaggaaagggcaaagg
caagaaaggaaaagatcagggcaagaccagctatttgtcgggcgccaagctggagttggt
aacgcacaccccagatggcaagcagatctgctatcgctataacatgaagggcaagaagtg
cgatggtaagtgcaacagggtccatatttgccgagtcagagacatccgagagcatttaga
gaacctggcagaacagtttcattatacattagaaatgcatgagtttgatcttttgcgggg
cgaagaccaagatgttttagacagtgatttttggacttcgttggttgatcgtgtgcggaa
agatcccccattttgcatcattgcaacaccaccttgctcaacctacagtcgggctagaca
cttctacaaggaatctccggggcccaggcccattcgcagcagacagtttcctttgggctt
tccatggttgtcgacatcaaaccgacaaaaagcagaagagggcacagcattagcttgcaa
gatgtgggaaatgtttgatatcgcacgtgagattggctcgcatttcctgggggagtttcc
ggaagatctgggggccacatctacaggtgttccggcctccatttggcagatggatgcttt
cttttcattgttggctaatccaggtgtgatgacaatggcacttttccaatgtgaatttgg
ggctagcaccccaaagcccacgaggctcatcacagatttgcagaactttgatggaccata
ccatgagggcattcctactttcacggcagattggaagtacttggggccactacccaaatc
ttgcccccatccaaaccagcacgagccattgataggtttggatgactccggcaaatggcg
aactggacctgccgctcactacccaggagaactatgcctcttcattgcaaaagccatagc
aaagaccttcgcttcgtgggggaggtccttgccacataagagagaacattcaggtgtgca
ttttgacggccccaagccacaggcaaatgcacactcacatcctccacaggctgggaggtc
cttgccacataagagagaacattcaggtgtgcattttgactgccccaagccacaggcaaa
tgcacactcacgtcctccacaggctgttgacgcgtctgttggtgcaaatttcggttttga
accttttgaggcacctttggatggagaagattgcacggctgtggaaactttggacattag
ctacacagaaattctctcaggctgctctggtccacctatgaccgcaagatatgctggcag
ggctgaaaacttcgtggacggattgggtctttgcagcttccaatcggactatgttggttt
ttggatggactactcaaaatttgagataggcctttctgaaagaagaaccacgtggctggt
ggatttcatcaaggagatggagcacaacgactggctggtcaatgtcaagaggtttcaaga
gttccatggtcgcttgggtttttcggcacaggtgttgccttggttgagacctttgttatc
tcctggttacgcctggttagctgcagttggcaaagcagctactcttcgggttccggaact
cttggcattgagttgcattttcattaaggagaagttcgccaaaggacttcgtaagattcc
ttgtggtctgaaagaactggagcttggggaacttttcagaactgatgccaaatgcgaacc
aggccgagtagtgctgggtggttggttgattgggagccgtgcagacccttgggaatctcc
ttggttctccttgactttgactccttctgaaacgccctggctattcaggggaccaaatca
ggaatcttcttgggcaagcacatcggctgaactgctgggatcccttgttgcactaaaggt
atttgatcttggcaaaaatttcaaacacctagcagcttctcatatcgtcaagtgtggagg
gggcacggacaacaaggcggccagctcggtcaccagcaagcgtctcagcaccaagctccc
tttgctgattatccttatggaatatttgggaacatgtgaagagattggtttgagatgcca
ccttgattggaggccacgcgataccaacacggaggcggacgatcttacaaatggtcgctt
cgaagcattccaggactcaagacgaattctaacgttggtggccgctgcatatggtttaga
tctggtaatgaagcccaaagtgtttggagttagccgctcctatggtgacttgcagaacat
tgacgtcattgagaacagatcagttcagtgcaagtcaggcttgccatctagataccagaa
gggcagattcttgggaaagggtggttttgcaaaatgctatgaagtgcaagacttggagag
caaggagaccttcgcagccaagattgtcgcaaaatcctctgtgaccaagccacgagcata
cgcgaagctcaggtccgaaatcgctatacacaaagagcttcaccatgaaaaagtagtgaa
gttctatgagcactttgaggacacggagtatgtgtacatcatgctggaagtttgtccaaa
cagaacattgaacgaattcatgcgtcggcgacctcccaaacgattggtggagccagaggc
catgttctacatgtacgatcttatcatggcgctccagtacctgcatcggcgaagagtaat
ccatagagatctgaagctgggcaacttgtttctggacaagaacatgaggctcaaggtcgg
cgactttggattagctgcacagcttgagtatgtcggtgacaagaggcacactatttgtgg
tactcccaactacattgcccctgagatccttgagggcaagcacggccactcattcgaggt
ggacatttggtctcttggtgtcatcatctacaccatggtctttggtcggcctccctttga
aacctctgacgtgaagaccacgtacaagaggattcgaagcaaccaatacagcttccctga
ttctgtgcgggtgtccaaccaggtgaaggacctcattggccacattctgcagttggatcc
cgggaagcgtccaagtctagagaatatcctcaattcgagctggctaagctcaagcagatt
tccaccaccaatgcctgaaagtatcagcttatgggtcacgtccagagggcaggtacctcc
aactacggctccaggtttgacgcctgtcctgtcagctcgacctgggttctctccatacaa
tctgcccagcacaccaggcagatgtcagccaggccggccacctgttgcccagcgcagcaa
caaggagaacatggtgcccaactatgacccagtagacttcaaggacaactgtttcaacgc
tggattagtggccatggctgctccaaaccgaaccctcagctctgcaaggcttggagacag
cgcaaggatacttgacagcccaagcaacgctgccactttgggtgcaccaggtgcagagga
gtttggacattttggaacctcaagtgcgagacagcaatcacctcgacgagctcccgatcg
aggcagcagaagcttgtcccctgctgttgtacgagcagctactccacggcaagaagtttt
tttggacgctctcagcactgtgcgtaaggctccggagttgcgccaaagagctggacttga
ctctagaccgccctcttcttaccgtgcctgcgggcaggtacaggcccagtctccaatgcc
tgagatttgggttacaaagtgggttgactatgccagcaagtatggtgtgggctacatttt
gtctgacgcttccattggtgtctacttcaatgactcgacaaagataatccttgttccaag
cggagacttctttgactacattacgcgcagaactccagagagagcggaggaacgcaacac
gtactcttgggagaactatcctgaggagctgaagaagaaagttattttgcttcgaaactt
caagaactatatggtgacggatgcgctggagcgcaaggatggcgcttcaacaggatcttc
aagcctgaagccacctgcagccaaggcgactggatgtgggcaagtgccttttgtcaagaa
gtggacacgcaacaagcatgccatcatgttccagctcagtaacaaaactgtgcaggcagg
ttccttgtgtttttttggaacagattttgcagttcttttgattcttctcgcaaaggtgat
tttctttgacaagactgaagctgtcctctcttccaagtcgcacactgtgacctacgttga
caagaggggccaggtgcagacctatcctcttacgaactctttcgatgtgccaagtgcaga
gcttgccaagagactacgctacacgaaggatattctggtgaatcttctgggctcacgact
acctgcgggacttccgagcgtttttgcaactgcttccgcataggtgtggcataagttgct
gatttagatcactgccaccgaaagactgaaaatgtttgaaagttgcaacaaattgcaacg
ctgatgtgacaattcaagtgcatgggcaaaagcttgcaagctagacagttttttgaaaga
tttgacgagcaaatctcgactctggtctagaggattagatatggtgggtcacctacctgc
ctgtgtctttattctccagaatcatggacttaagtaggactggagcgactggatggttca
aagtacacttagtatggacaaaacatcaaaaatcctagtctactcgattgaacgttgagg
tcttgaaccaaccattaattaatacaattcactcaagaac

DBGET integrated database retrieval system