KEGG   Breviolum minutum: v1.2.020359.t1Help
Entry
v1.2.020359.t1    CDS       T04349                                 

Gene name
symbB.v1.2.020359.t1
Definition
(OIST) -
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smin  Breviolum minutum
Pathway
smin00450  Selenocompound metabolism
smin00970  Aminoacyl-tRNA biosynthesis
smin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smin01007]
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smin03016]
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
Enzymes [BR:smin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     v1.2.020359.t1 (symbB.v1.2.020359.t1)
Amino acid related enzymes [BR:smin01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   v1.2.020359.t1 (symbB.v1.2.020359.t1)
Transfer RNA biogenesis [BR:smin03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
 Prokaryotic type
   Other AARSs
    v1.2.020359.t1 (symbB.v1.2.020359.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
AA seq 631 aa AA seqDB search
MQPLQPLPGVSTARRLQPQRLQGVQRRWHVFNEARYTTNAGQTTLVAGLGLSLCQRLARP
SKAKANVRMFATAVTTAAIEDQVEEDSANFKRPRLRLDKDDAGKLQKLMITTPLFYANGS
PHIGSAYPAIAADVIARYGKLREAEVHYVTGMDEHGEKIAQTAAGQDKTPQELVDGIASE
FQDLWDLLKVQPDHFARTTPSQHKEIVHEMWQRCLDNGDIYKKDYTGYYCVGCEAYLDDD
EMDEGHICKIHQKECVLRSEENYFFRLSKYWGAVRQHIEENPDFILPTSRRSQVLVWLEE
DNKRDFSISRASTSWGIPVPGDDSQVIYVWFDALLGYLSSLLQPDDPATLDTVLKRGWPA
DVHVIGKDIMRFHAIYWPAMLMSAGLPLPKHICTHGFLTKDGLKMGKSLGNVVEPIPLVN
DFGPDAVRFFFSSCLSFGLDGDFSYETFIKRVNSSLANELGNLVHRILTLLRKNLPDPTS
PLDLVENSAEFDHHPVRIAAEKAPEAVATCYEQTDIPKAVMKALDIATVANVRMNEVEPW
VKLKKTTSQEEKDLALRELLVMAEGVRICTLLLSPVTPGLCAKIFAEFGLDGEGLSWKDT
AWRWDVIPGLAAGPKPTPVFQRIDLEAWEGK
NT seq 2017 nt NT seq  +upstreamnt  +downstreamnt
tgtagttgctaagtgatatttggccatgcagcctttgcaacccttacctggcgtttctac
cgcacggcgtttgcaaccacagagactccaaggcgtgcagcgaaggtggcacgttttcaa
cgaggcgagatatacaacgaatgcggggcagacgaccctcgtggccgggctcggcttgag
tttgtgccaacgtttggctcggccaagcaaagccaaagcaaacgtgaggatgtttgcaac
tgctgtcactacggcagctatagaggaccaagtcgaggaagattctgcaaatttcaaacg
accaagacttcgtttagacaaagatgatgcaggtaagctgcagaaactgatgatcacaac
tcctttgttctatgccaatggttctcctcacattggaagcgcttatccagccattgcggc
cgatgtcatcgctcgctatggcaaattacgagaagcagaagttcactatgtgaccggcat
ggatgaacatggtgaaaagattgcacaaacagcagctggccaagacaagactcctcaaga
gcttgttgacggaattgcatcggaatttcaggatttatgggatttgctgaaggtgcagcc
ggatcattttgcccgaactactccatcacaacataaggaaattgtccatgagatgtggca
gcgatgcctggacaatggtgatatctacaagaaagactacacaggttactattgcgttgg
ctgtgaagcctatttggatgatgatgagatggacgaagggcacatttgcaaaatacacca
aaaagaatgcgttttgcgcagcgaagaaaattacttcttccggctctccaagtattgggg
tgcagttcgccagcacatcgaggagaacccagattttattctaccaaccagccgacgaag
tcaagttctagtgtggctggaagaagacaacaagcgtgatttttccatttctagagcaag
cacatcatggggaatcccagttcctggtgatgattcacaggtcatctacgtttggttcga
tgctcttctaggatatttgtcatcactgctgcaacctgatgatcctgcaaccttggatac
cgttctgaagcggggttggcctgcagatgtacatgttattggaaaagatatcatgagatt
tcatgccatttactggcccgcaatgctgatgtctgcagggcttccattgccaaaacacat
ttgcactcatggtttcttaaccaaagatggcttgaagatgggcaaatcattgggaaatgt
ggttgagccaattcctttggtgaatgactttggtccagatgcagttcgcttctttttttc
aagttgtctctcatttggtttggatggtgacttcagctatgagactttcatcaagcgagt
caacagtagccttgccaatgaactgggaaacttggtccatcgaatcttaacccttttgag
gaagaacctgccggatccaacttctccccttgatctagtggagaatagtgctgaatttga
ccatcatcccgtccgaattgctgcagagaaggctccagaagctgttgcaacctgctatga
gcagaccgatatccccaaggctgtaatgaaagcccttgatattgcgacggttgccaacgt
tcgaatgaacgaggtagagccatgggtcaaattgaagaagacgaccagtcaagaggagaa
agacttggctttgcgggaactactggtaatggctgaaggtgttcgcatctgcaccctgtt
gctgtcaccggtcacaccgggactctgcgccaagattttcgcagagttcggtcttgacgg
tgaaggcctttcctggaaggacactgcttggcggtgggatgtgattcctggattagcagc
cggaccaaagccaacgcctgtgtttcaacgaattgacttagaagcctgggaaggaaaata
gctgatgattttcgtcgcacgcccaaggccgaaacttatggccgagattttcgcgaccga
tttgcgcgggtacaggaaataagattctggtaacaac

DBGET integrated database retrieval system