KEGG   Breviolum minutum: v1.2.022250.t3Help
Entry
v1.2.022250.t3    CDS       T04349                                 

Gene name
symbB.v1.2.022250.t3
Definition
(OIST) -
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
smin  Breviolum minutum
Pathway
smin00072  Synthesis and degradation of ketone bodies
smin00280  Valine, leucine and isoleucine degradation
smin00650  Butanoate metabolism
smin00900  Terpenoid backbone biosynthesis
smin01100  Metabolic pathways
smin01110  Biosynthesis of secondary metabolites
smin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    v1.2.022250.t3 (symbB.v1.2.022250.t3)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    v1.2.022250.t3 (symbB.v1.2.022250.t3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    v1.2.022250.t3 (symbB.v1.2.022250.t3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    v1.2.022250.t3 (symbB.v1.2.022250.t3)
Enzymes [BR:smin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     v1.2.022250.t3 (symbB.v1.2.022250.t3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank_5 Ank_4 Ank HMG_CoA_synt_N HMG_CoA_synt_C
Motif
AA seq 794 aa AA seqDB search
MAAMLLDSNPSHLTSSTDVPGARNAIGRIDIGTESIQDRSKSMKSYIMDIFERYANESNI
EGVDQYNACYGGQACGLCTLSWVESDRWDGRYGIAVATDISEAHPGFMAFVGAATTAALF
FPDAPMSHHSQRASCVLHRFDFCKPVGWHDMAPITDGKYSVECYLDALDACHSTLRQKLN
GRGPLEVTDLNVFHTGGGYHIVRKAFERLVRAENKGIKPDEKERLLQEKLMPSVALLKII
GPCHTVSSFLNTGSVIMNKMEQALGKIILVFTYGSGCAASMYQMRVDDVPFFDPFEIWKL
QFYRNAIKVTPEESVPLHHYYVQTWMKFDYFPQGRRTCKISLWKYEEDAYYLMQIDKFGR
RFYHRGGLSSGPMDPSLKLPVDKAEERPTRESWGPVLVRPEEKTVKAISNKPSKEDRFKE
IEYRPRCESCKLVSRTFSGLPPNDASTWEELGKPEELQVVILPIGNGSEEKLLEAAEKGD
VTTVKHLLQEPADPNCRDPQTHKSPIVKASARGHLKVVKLLLKAHANVELRDGSMNTPLM
SAASHGHVEVAKCLMSAGAQKDETDEHGRTALILASTEGHLEVVRLLCEEGCNKDAVDRH
GRNSLHCAVTHARGEVAKYLLEQQVDKDQLDRQGRSSLHEAVLSPRTFGLVRHLLDAGVD
KHKADTEGLSHYFRFGNLGVVRTLLDAGAHTEMADSDGWTPLHVASWYGHLHLVRVLCQV
CLRDTMDQQGRTPLFVACCNGHAEVVRCLIQSLVNRAGCDRNRRDAMGRCPLFEAARLRC
GAVVEIMCQVVQDF
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
gtttttttgacaaacagctgttacttgggccttgaacagataagaacacagagatgaaca
caaagacgtacgaacatattcagggcgatgtacacgtatggcaaataaatttcatgtgtt
tacgatagaaaatggggtcatgttctggtaaaatgttggtaaatataccgccatatattt
ttggtttggatagtagcccatgcaattttttatgcttacaccaagggttcctggttgatg
ttgattctcaactgtgaagggtggcttggtcttccacttcctaaagtgggggcttctgtc
ccccgaaaagaaagtgtgtttccaaaaggatcatggctgccatgttgcttgattccaatc
caagtcaccttaccagctctactgacgttcctggtgcaaggaatgctattggccgcattg
acattggtaccgaatccattcaggatcgttccaagtcgatgaagagttacatcatggaca
tctttgaacgttacgccaacgagtccaatattgagggtgtggatcaatacaatgcttgtt
atggtggtcaagcctgtggtctatgcaccttaagttgggtagagtcggaccgctgggatg
gacgttatggtatcgctgtggcgacggatatctcagaggcacatcctggttttatggcct
tcgtaggtgctgcgacaacagcagcactcttcttcccagatgcgccgatgtctcaccatt
ctcagcgtgcttcctgtgttttgcatcgtttcgacttctgcaaacctgttggatggcatg
atatggcacccatcacagatggcaagtacagcgtggaatgttaccttgacgcgcttgatg
catgtcactccacattgaggcaaaagttgaatggtcgaggaccccttgaggtgacggacc
tcaatgtcttccacactggtggtggctatcatattgtccgcaaggccttcgaacgtttgg
tgcgtgcagaaaataagggcatcaaaccagacgagaaggagcgcttgcttcaagagaagc
tcatgccatcggtggctctgttgaagatcatcggtccttgtcatactgtgtcgtcgttcc
tgaacactggttctgtcatcatgaacaagatggaacaggcccttggaaagatcatcttgg
tctttacctatggttcaggctgtgccgccagtatgtaccagatgcgtgtggatgacgtgc
ctttcttcgatcctttcgagatttggaagttgcagttctatcgcaatgccatcaaggtga
ctcctgaagagtcggttccattgcatcattactacgttcagacgtggatgaagtttgatt
atttcccgcagggaagaaggacttgcaagatctcactctggaaatacgaagaagatgcct
attacctcatgcagatcgacaaatttggtcgacgcttttatcatcgaggtggcttgtcat
ctggtccaatggatcctagcttgaaattaccagtggacaaggcagaggaacgtcccacac
gtgaaagttggggtccagtcttagtgcgcccggaagagaagacagtcaaggccattagca
acaaacccagcaaagaagatcgcttcaaagagattgagtacagacctcggtgtgaatcct
gcaagttggtttcaagaaccttctctggtttgccacccaatgacgctagtacttgggaag
aattgggaaaacctgaagaattgcaggtggtgattcttcccattggcaacggatcagaag
agaagctcttggaggcagctgagaaaggtgatgtgacgactgtgaaacatcttttgcaag
aaccagcagatccaaattgccgcgatccacaaactcacaagtcgcctattgtgaaggcca
gtgcacgtggtcacctgaaggtggtgaagttgttactcaaagcccacgcaaatgtcgaat
tgcgtgatgggagcatgaatactccactgatgagtgctgcaagccatggacatgttgagg
tggcgaagtgcttgatgtcagcaggggcgcaaaaagacgagacagatgagcatggtcgaa
cagctttgatcttggcatctacagaagggcatttggaggtggttcggcttctttgtgaag
aaggatgtaacaaggatgcagtggaccgccatggccgcaattccttacactgtgctgtga
cgcatgcgcggggagaggtggcgaaatacctcttggagcagcaagtggacaaggatcagt
tggatcgacagggacggtcctcgttacacgaggccgtgctgtcgccaagaacttttggat
tagtgcgacatttgttggacgccggagtggacaagcacaaagcggacactgaaggtttgt
cccactattttaggtttgggaacttgggtgtggtgcgcaccttgttggatgcgggcgctc
acacggagatggcggacagtgatgggtggactcccttgcatgtggcaagctggtatggac
atcttcatttggtacgcgtcttgtgtcaggtgtgtttgagagataccatggaccagcaag
gacggacgcccttgttcgtggcgtgctgcaatggacatgcagaggtggttcgctgtttga
tacagagccttgtcaaccgggctggctgtgatcgtaatcgtcgggatgctatgggacgat
gtcctttgttcgaagcggctcgcttgcgctgtggcgcagtggtggagatcatgtgtcagg
tggtgcaggatttctgaactatcaacaggtttccatgtagctcacaatgataggccaagg
cgcaaatggatcaaacagatcagcatggcaggacgccattgcatgttgcagtttggagtg
gttccatacacatcgtggatttgttgttgcgctccgctgattacaacaaagccgacctct
acggaaggacacctctcttcttatctgccttcctgggacatttaccaatgactcggcttc
tggttgatgctggtgtgccttgaagatataccaagtcacgatcacatcctggggggctga
agaacggaaatgaatagaagttgtccatttaccaaaaatatttctaccttgctatactag
aaggaatcaatttgttgagaattg

DBGET integrated database retrieval system