KEGG   Breviolum minutum: v1.2.022569.t1Help
Entry
v1.2.022569.t1    CDS       T04349                                 

Gene name
symbB.v1.2.022569.t1
Definition
(OIST) -
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
smin  Breviolum minutum
Brite
KEGG Orthology (KO) [BR:smin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    v1.2.022569.t1 (symbB.v1.2.022569.t1)
Enzymes [BR:smin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     v1.2.022569.t1 (symbB.v1.2.022569.t1)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     v1.2.022569.t1 (symbB.v1.2.022569.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase DUF3431 cNMP_binding AAA_18
Motif
AA seq 856 aa AA seqDB search
MLSKSLKPCAPLLVDGRSLVNPLGLRLKSFQTFQAGEFAKHAVGPVALTAVAGSVNRRRR
GRTHRRAEAEANGGTLTDDDITLLRQVLPEVKELVVLRKSNTDVILELAKTMVPTVVEEG
TTIAQQGQPDDSMYIIAEGDVVLEIPWAGHVDLERRPVARGSYIGAECLLGNTPHKCSAV
AQSSCRLLRLHRDTFDAIIMSQTDEEALDEDDEGDGDTCTASQLVNIFVLSDSTGESANA
SVKTAAAQFEYCSGSTCATSRATVYRFVRSSAEIKSIIEAAKKCNALLVYTIMDPKLHQV
VEDECKDKELEGIDLWGPLLTSFERRFGAKRSGKAGRRQAVSDDYMTIVKAIEYTRKVDD
GVLPHLWDECDIMLIGPSRAGKTPLSFYLAQRGYKVANYPLVPEEEPPQELFDIDQQKCF
ALQIKPERLQEIRTQRMKQFNRSNTQYANLTNIKKEVSWIKNFYLRRGPKWPIIDTSNAG
VVETAARIMEILDRRKGDAVAASYQQSHHINGWPLVDGLRRIHALRALRPPGEPRTTTAV
DLVLCYCGRGERIEWLHGFHRLPWRHEDRSEAIRASVSLRIYHKCGSVVEQEREEESQKL
IKTWSSWFHTVEVRYVDDEIRADDCSAYLAYIVDRYEDMPEVAVFLHADAPEHIPTIDLL
MDSVFAAARGYLPPEAGFVHLAHNYVRHDCPGSTQSCTTPDAFEVSQLWRKVFQSSITPV
MSEGDLNGYCCVQFLVRRGRVRLRSKDFYVRALNFFGETAASYYALFPVDTRGRTPCQLT
MYFWHVIFGEDLWLPRRHRDQRLPLFIRILNIEAEAALEAQRGEDGPGSAVIQFTDDTSR
ADETYYRLQSLFSDDG
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
acaggctccgaagagcatttcctgtgattgcagattccaaagctttgtaaaagatgctta
gcaaatcgctgaagccatgtgcaccgctgttggtggatggccgcagcctggtcaatccct
tggggttgcgactgaagagcttccaaaccttccaggctggcgagttcgccaagcatgctg
ttggtcccgtagccttgactgctgtggcagggtcagtgaatagaaggcggcgagggcgga
cccatcgccgtgcagaggccgaggcaaacggtggaactttgacagatgatgatatcacct
tgctgagacaggtacttccagaggtgaaggagctggtggttctgcgtaaaagcaacacag
atgtcatcctagaactggccaagaccatggttcctaccgtggtggaggaaggaacaacaa
tagcgcaacaaggacaacctgacgacagtatgtacatcattgcagagggcgatgttgtgt
tggaaatcccctgggccggccacgttgatcttgaacgccggcccgtggcgcgggggagtt
acatcggtgccgaatgcttgttgggcaacacgccgcataagtgctccgccgtggcacaaa
gttcctgtcgattgctgcgcttgcatcgcgacacttttgatgccatcatcatgtctcaaa
cagatgaggaagctttggatgaggatgatgaaggtgatggagacacttgcactgccagcc
agcttgtgaacatttttgtcctctctgatagcactggagaatctgcaaatgcctctgtca
aaactgcagctgcgcagtttgagtactgttctgggtcgacatgtgcaacaagccgtgcca
cagtgtatcgattcgtgagatcttcagcagagatcaagagcattattgaagcagccaaga
agtgtaacgccttgctagtctacaccatcatggatccaaagttgcatcaggttgtggaag
acgagtgcaaggataaagagcttgagggtattgacctttgggggcctttgctcacatcct
tcgagagacgttttggtgccaagcgcagtggcaaagcaggtcgccgacaggcagtcagtg
atgactacatgaccattgtaaaggcgattgagtatacccgaaaggtggatgatggcgttt
tgcctcatctttgggatgagtgtgatattatgctgattgggccatcgcgtgctgggaaga
cgcccttgtctttctatttggcgcagagaggctacaaggtggcaaactatccactagtgc
cagaagaggagcccccacaggagctctttgatattgatcagcagaagtgtttcgctttgc
agatcaagcctgaaagattgcaagagatccgtacgcaacggatgaagcagttcaatcgct
ccaatacacaatatgcaaacttgacaaacatcaagaaggaagtgagttggatcaagaact
tttacttgcgacggggtccaaagtggccaatcatagacaccagcaatgcgggtgtggtgg
agaccgctgcgcggatcatggagattctggatcggcggaagggggatgctgttgcagctt
cctatcagcaaagtcatcacatcaacgggtggcccctggtggatggcctgcgtcggatac
atgctctccgagctttacgaccaccgggtgagccaaggacgaccaccgcggtggatctgg
ttctatgttattgcggtcgtggggagcgcatcgagtggctccatggctttcatcgtttgc
catggcgacatgaggaccgatccgaggcaattcgtgcgtcagtgtctttgaggatatatc
acaagtgtggatccgtggtcgaacaagaacgagaggaggagagtcagaaattgatcaaaa
cgtggtccagctggtttcatacagtggaggttcgttacgttgatgatgagattcgagcag
atgattgctcagcataccttgcctatattgtggatcgatatgaagacatgccggaggtgg
ctgtatttctacatgcagatgcacccgagcacatccccacaattgacttgctgatggact
ccgtctttgcagctgcaaggggctatcttccaccagaggcaggcttcgtccatttagcac
acaactatgttcgacatgattgtccaggaagcactcaaagctgcacaacacctgatgctt
tcgaagtctcgcagctttggaggaaggtcttccaatcctctatcactcccgtgatgtcag
agggtgacctgaatggctactgttgtgttcaattccttgtacggcgagggcgtgttcggc
tgcggagcaaggatttctatgttcgtgctctgaacttcttcggtgaaacagcggcatcct
actatgcgcttttcccggtggatacgcgtggccgcaccccttgccaactaaccatgtact
tttggcatgtgatttttggggaagacctttggctaccgcgaaggcacagagaccagcgac
tgcctttgttcattcgcatcttgaacattgaggcggaagcagccttggaggcacaacgag
gtgaagatggtccaggatccgcagtgattcagttcacagatgacacgtccagagctgatg
agacgtactatcgactgcaaagcctcttttcagatgacggatgaattggcactgcttgcc
acctgggccagacatggaaacttttcatcgacctggactcctgccaccttgcgccaaatg
tccagccatgtggctcagcgttgcatgcaggccgccaagtcagccctcaaggacaatgtg
aagccgtgggagaaagccaaggtcagactccaattgaattcttcagctcaacgagaaccg
aatcatgcaggttggatcaggcagccggattctccaagctctcgtcgcagccatgctacc
gaggaggagccacctcagattaagaggagtcttctgaaacatgcggatcaactggatcag
caggaagcgcttttctgcaaagacatgcgacgcttgactcgaatggccaaa

DBGET integrated database retrieval system