KEGG   Breviolum minutum: v1.2.026295.t1Help
Entry
v1.2.026295.t1    CDS       T04349                                 

Gene name
symbB.v1.2.026295.t1
Definition
(OIST) -
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
smin  Breviolum minutum
Pathway
smin00020  Citrate cycle (TCA cycle)
smin00640  Propanoate metabolism
smin01100  Metabolic pathways
smin01110  Biosynthesis of secondary metabolites
smin01130  Biosynthesis of antibiotics
smin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    v1.2.026295.t1 (symbB.v1.2.026295.t1)
   00640 Propanoate metabolism
    v1.2.026295.t1 (symbB.v1.2.026295.t1)
Enzymes [BR:smin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     v1.2.026295.t1 (symbB.v1.2.026295.t1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     v1.2.026295.t1 (symbB.v1.2.026295.t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
AA seq 281 aa AA seqDB search
MTGRQGTFHTTQAIEYGTNMVGGVNSKKGGTTHMNLPIFANCMEAKKETSCDASVIYVPP
PAAAAAVLEALEAEIPLIVCITEGIPQQDMVKVKHALMRQNKSRLIGPNCPGIIKPGECK
MGIMPGYIHKAGKIGIVSRSGTLTYEAVHQTTVTGMGQSTCVGIGGDPFNGTNFIDCLEK
FAADPETEGIIMIGEIGGSAEEEAADWIKANCQHKPVVSFIAGITAPPGRRMGHAGAIIS
GGKGTAQDKIAALEKAGVWVTNSPAELGTTMVKAMEAAGKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ctcagagactgccccggaagctgtgcgagtctttgcgctgtgcaagccggctggtgactg
accatgcagcgcctctttgggaacttgtcagccaggcagttggcgggcgccgtgcgccac
tcctcgactgccaaggtgtggatcaacaaggacaccaaagtcatttgccagggaatgaca
ggcaggcagggtactttccacaccacccaggccatcgaatacggcaccaacatggtgggt
ggcgtgaacagcaagaagggtggcaccacacatatgaaccttccaatctttgccaattgc
atggaagccaaaaaggagacaagttgtgatgcctctgtgatctatgtgccaccaccagca
gcagctgcagcggtcctggaggctttagaggcggagattccattgattgtgtgcatcact
gaaggcatccctcagcaggatatggtgaaggtgaaacatgcactgatgcgtcagaacaag
tctcgcctgattggaccaaattgtcctggaatcatcaagcctggtgagtgcaagatgggt
atcatgccaggatacatccacaaggccggaaagatcggcattgtcagcaggtctggcact
ttgacctatgaggctgttcatcagaccactgtcactggcatgggacagagcacctgcgtg
ggcattggcggcgatcccttcaatggcaccaatttcattgattgcctggaaaagtttgcc
gccgaccctgagacagaaggcatcatcatgatcggcgagattggtggcagtgcagaggag
gaagctgctgactggatcaaggccaactgccagcacaagcccgtagtgtcctttatcgct
ggcatcacggcacctccagggcgccgcatgggccatgctggcgccatcatttctggtggc
aagggcacagcacaggataagatcgcagcactggaaaaggctggcgtttgggtcaccaac
tctcctgctgagctgggtaccactatggtcaaggcaatggaagcggctggaaagaaatga
ccgaatccagtcgtcggttgacgacgacttcagttcaaaggaagccctgatccattgacg
tcaaagtctgaggttggagtgtttttggtggggact

DBGET integrated database retrieval system